KEGG   Rickettsia japonica: RJP_0131Help
Entry
RJP_0131          CDS       T01637                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rja  Rickettsia japonica
Pathway
rja00020  Citrate cycle (TCA cycle)
rja00190  Oxidative phosphorylation
rja00650  Butanoate metabolism
rja01100  Metabolic pathways
rja01110  Biosynthesis of secondary metabolites
rja01120  Microbial metabolism in diverse environments
rja01130  Biosynthesis of antibiotics
rja01200  Carbon metabolism
Module
rja_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rja_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rja_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rja00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RJP_0131 (sdhD)
   00650 Butanoate metabolism
    RJP_0131 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RJP_0131 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt tRNA_anti_2 CybS PAP2
Motif
Other DBs
NCBI-ProteinID: BAK96354
UniProt: G4KM46
Position
174017..174394
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWE
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCYKLRNTLIIIVQLFCIVTIVAFVVA
LFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtgtatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcaaagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaacaaaaataatgatataaatattattatgtgggaa
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaggattatatcagttgttacaaattacgtaat
acattgattataatagtgcaattattttgcattgttactattgtagcttttgtagtagcg
ctgttttataaaggataa

DBGET integrated database retrieval system