KEGG   Rickettsia japonica: RJP_0464Help
Entry
RJP_0464          CDS       T01637                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rja  Rickettsia japonica
Pathway
rja00020  Citrate cycle (TCA cycle)
rja00640  Propanoate metabolism
rja01100  Metabolic pathways
rja01110  Biosynthesis of secondary metabolites
rja01120  Microbial metabolism in diverse environments
rja01130  Biosynthesis of antibiotics
rja01200  Carbon metabolism
Module
rja_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rja_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rja00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RJP_0464 (sucC)
   00640 Propanoate metabolism
    RJP_0464 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RJP_0464 (sucC)
Enzymes [BR:rja01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RJP_0464 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: BAK96678
UniProt: G4KN20
Position
complement(593918..595078)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYSVPTSTGLVVTKTEKINETIDKLNTEVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSIVFDRSASC
ITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEI
VKSVYNAFIETDAAQIEINPLIVNSDGNLLALDAKITFDDNGLFRHPNITAMRDHDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGASPANFLDVGGGADRERVKE
ALKIILSDKEVQGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGEEI
LSNSGLEIIPAHDLADAANKIVEAIR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatacagcgtacctacttcc
accgggctagttgttacgaaaaccgaaaagattaatgaaaccatagataaattaaatacg
gaagtatatgtggttaaagcacaaatacatgctggcggtagaggtaaagcaggcggtgtt
aaggttgttaagagtaaagaagaagccaaaaaagttgctcatgacatgtttggtattaat
ttagtaacgcatcaaacaggacctcaaggacaaaaagtaaaccgtctttatatcgagtca
ggttgtgatattttaaaagaatattattttagtatagtatttgatagatcggctagctgt
attactttcatagcttctacagaaggaggagttgatattgaagaagtagcagaaaaaact
ccggaaaaaattattaaattttccgttgatcctgcaaccggtttacaagattttcatatg
cgaggcatagcttatgagttaggctttaaggataaccaagccaaacagatgaaagaaata
gtaaaatcagtctataatgcttttattgaaaccgatgcagcacaaattgaaatcaaccca
ttaattgtaaatagcgacgggaacttattagctttagatgcaaaaattacttttgacgat
aacggcttatttcggcatccgaatattacggcaatgcgtgatcatgatgaagaagatcct
ctagaaactagagcagcaaatgcaggacttagctatgtaaaaatggacggtaatatcggt
tgcatggttaacggtgccggtcttgccatggccactatggatattattaaactttacggt
gcttcgcctgctaatttcttggatgtcggtggtggagctgatcgtgaacgtgtaaaagaa
gctttaaaaataattttatctgataaagaagtacaagggattctagttaatatttttggc
ggtatcatgcgttgtgatattatagcagaagggattattgcagctgcaaaagacataggt
ataaaagtaccgttagtagttcgtttagccggtacaaacgttgaaaaaggcgaagaaatt
ttatcaaattccggtttagaaataataccggcacatgatttagcagatgcggcaaataaa
atagttgaagcgatacggtag

DBGET integrated database retrieval system