KEGG   Rickettsia japonica: RJP_0473Help
Entry
RJP_0473          CDS       T01637                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
rja  Rickettsia japonica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rja00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RJP_0473 (recR)
DNA repair and recombination proteins [BR:rja03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RJP_0473 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
602336..602941
Genome map
AA seq 201 aa AA seqDB search
MNETNDNDIDQLIYLFSKLPGLGSRSARRIALYLLQDKDVRLKSLINNLVEIDKKIVKCE
ICGNMDTENICRICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASRQN
PSILRLPELRTRCFAENIKEVIIATNSTLEGQTTAYFITEYLKEHPAKISRLASGIPIGG
ELDYLDEGTVSAAINLRQPFE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacaaatgataatgatatagatcagctaatttatcttttttcaaaattaccc
ggtcttggtagtagatcggcaaggcgtatagcgctttacctattgcaagataaagacgta
aggttaaaaagcctaattaataatcttgtagagatagataagaaaatagtaaaatgcgag
atttgcggtaatatggatacggaaaatatttgccgtatttgttcttctgaatatagagat
aaatcaattattgctattgtcgaaactgtggctgaattatgggcaatggaacgtagcggt
aattttaaaggtttatatcatgtactcggtcataatttatcggcagctagtagacaaaac
cctagcatacttcggttacctgaactacgcacaagatgttttgcagaaaatattaaagaa
gttattattgctactaattctactttagaaggtcagactactgcttattttattacagaa
tatttaaaagagcatcctgctaaaatttctcgccttgctagcggtatacctatcggaggt
gaacttgattatttagacgagggtaccgtatctgccgctattaacctacgccaacctttt
gagtaa

DBGET integrated database retrieval system