KEGG   Rickettsia japonica: RJP_0785Help
Entry
RJP_0785          CDS       T01637                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosidase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rja  Rickettsia japonica
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:rja00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    RJP_0785 (mutM)
Enzymes [BR:rja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     RJP_0785 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     RJP_0785 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
983809..984630
Genome map
AA seq 273 aa AA seqDB search
MPELPEVETLKNSLKDKLIGLIIENVELKRDNLRYKLSTLLATEILNTNILDVRRRAKYL
IIDFNNDYSLIVHLGMSGRLTLQSANYKTQKHDHVIFDLSNGEKLIFNDTRRFGMIYSFK
TDLLEKEFFNDLGIEPFSDLLTLEYLKDKLQTKKIPIKNLIMDNRVVVGVGNIYASESLH
LARIHPDKSGSDLRDDEIENLIKSIRDVLTKAITAGGTTLKDFVNGDNKPGYFTQQLTVY
GREGQSCLSCSSTIIKTKHSGRSTFYCKTCQYS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacttcctgaagtagaaactcttaaaaactctctaaaagataagctaatcggg
cttattatagaaaatgtagagttaaaaagagataatttacgttataagctatccacgctt
ttagctacagaaatcttaaatactaatatactggatgttaggcgtcgtgcaaaatattta
attatagattttaataatgattattctttaatagttcatctaggcatgagcggtagactt
actctgcaatctgctaattataaaactcaaaaacacgatcatgtgatttttgatttaagt
aacggcgaaaagttaattttcaacgatactagacgattcggtatgatttatagttttaag
actgatctcttagaaaaagaattttttaatgatttaggcatagagcctttttctgattta
ttgacgttagaatatctaaaagataagctacaaactaaaaaaataccaataaaaaacttg
attatggataatagagttgtagtcggagtcggtaatatctatgcttccgaaagtcttcat
ttagctagaattcatccggataaatcaggtagcgatttaagggatgatgaaatagaaaat
ttaattaaatcgattagagatgtgttaactaaagctataactgccggcggtactactctt
aaagattttgtaaacggcgataacaaacctggttattttactcagcaacttacggtttac
ggtagagagggacaaagttgtttaagctgctctagcactattatcaagacaaaacattca
ggcagaagtactttttattgtaaaacttgccaatatagttaa

DBGET integrated database retrieval system