KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_08665Help
Entry
RLEG3_08665       CDS       T03009                                 

Definition
alpha-amylase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RLEG3_08665
Enzymes [BR:rlb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RLEG3_08665
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RLEG3_08665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
unnamed:400833..404114
Genome map
AA seq 1093 aa AA seqDB search
MDTLNPDGMNQPLWYKDAIIYQLHIKSFYDANGDGVGDFAGLHQKLDHIAALGVNAIWLL
PFFPSPRRDDGYDIADYGSVSSDYGTVEDFQAFVDAAHQRNIRVIIELVINHTSDQHPWF
QRARQAPAGSPERDFYVWSDTDQKFPETRIIFIDTEKSNWTWDAVAGAYYWHRFYSHQPD
LNFDSPLVMEELLRVMRFWLETGIDGFRLDAIPYLVEREGTINENLPETHAILKRIRAAL
DATHPGVMLLAEANQWPEDTREYFGEGDECHMAFHFPLMPRMYMAIAKEDRFPITDILRQ
TPEIPDNCQWAIFLRNHDELTLEMVTDAERDYLWETYASDKRARINLGIRRRLAPLMERD
RRRIELMNALLLSMPGTPVIYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRNGGFSRVDPA
RLVLPPVADPLYGFEAVNVEAQSTDAHSLLNWTRKMLALRGRHPAFGRGSLRFLSPENRK
ILAYLREYEGETLMCVANLSRLPQAVELDLSAFEGRVPIELTGMSPFPPIGQLTYLLTLP
PYGFFWFQLEADADPPAWRTAPPEQLPDLVTMVIRRGLLDLVDEPKLARTLSTEILPAYL
AKRRWFGAKDQALQAARLISATPIPFADGIVLGELEAVLPSHSESYQLPLAVAWDDAQPS
ALTQQLALGRIRQGRRVGFLTDGFAVEAMARGILRGLGDRSRITGRTGTLEFLGTERLDR
LEVTDDLPVHWLSAEQSNSSLIVGDLAMIKLIRHIFPGIHPEVEMTRYLTRAGYDHTAPL
LGEVAHTDSSGRRSTLIIVQGAIRNQGDAWNWMLNNLRRGADELVLNDPAVQPGDDVFRP
LISFVAMVGLRLGELHVVLAGDTGDEAFSPVVAGDSEVEAIKKAVAGEVAYALSKLDERA
ENADPAIDLLAAPLLERRSELVELAATLAESTRDMLMTRTHGDFHLGQILVSEGDAVIID
FEGEPAKNLTERRAKTNPLRDVAGLLRSLNYLVATAQLDNDAVIEHENEVRREAIARFGR
HAEEAFLDAYSQAVSVSKELDMPPDQRRRVLDAFLLEKAAYEIAYEARNRPKWLPIPLSG
FTEIVSRLAGVKA
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atggacaccttgaatcctgatggtatgaaccagccgctctggtacaaagacgctatcatc
taccagctgcacatcaagtcgttctacgacgccaatggcgacggggtcggcgacttcgcc
ggcctgcaccagaagctcgatcacatcgcagccctcggcgtcaatgccatctggcttttg
cccttctttccctctccgcgccgagacgacggctacgacatcgccgactatggcagtgtc
agctccgattacggaacggtggaggacttccaggctttcgtcgacgccgcccaccagcgc
aatatccgcgtcatcatcgaactcgtcattaatcacacctccgatcagcatccctggttc
cagcgcgcgcgccaggcgccggcgggatcgccagagcgcgacttctacgtctggtccgat
accgatcagaaatttccggaaacgcggatcattttcatcgatacggaaaaatccaactgg
acatgggacgcggtcgccggcgcctattactggcaccgtttctattcccatcagcccgac
ctcaatttcgatagcccccttgtcatggaggaattgctgagggtgatgcgcttctggctg
gaaaccggcatcgacggatttcgtctcgacgcgatcccctacctcgtcgagcgcgagggg
acgatcaacgaaaacctgccggaaacccacgcgatcctcaaacgcatacgcgccgcgctc
gatgccacccaccccggcgtgatgctgcttgccgaggccaatcaatggccggaggacacg
cgcgaatatttcggagagggtgacgaatgccacatggccttccacttcccgctgatgccg
cgcatgtatatggccatcgccaaggaggaccggtttccgatcaccgacatcctgcgccag
acgcctgaaattcccgacaactgccaatgggcgatcttccttcgcaaccatgacgagctg
acgctcgaaatggtgaccgacgccgagcgggattatctctgggagacctatgcatccgac
aaacgtgcccgcatcaatctcggcataaggcggcgcttagcgccgttgatggagcgcgac
cgccggcggatcgagctgatgaacgcgcttcttctgtcgatgccgggaacgcctgtcatc
tattacggggacgagatcggcatgggtgacaatatctatctcggcgaccgggacggggtg
cggacgccgatgcaatggtcgccggaccgtaacggcggcttctccagggtagacccggcg
cgtctcgtcctgccgccggtcgcagatcccctttacggtttcgaggcggtcaacgtcgag
gcgcagagcacggatgcgcattcgctgctcaactggacgcgcaagatgctggcgctgcgc
ggcaggcatccggccttcgggcgcggctcattgcggttcctctcgcctgagaaccgaaag
attctcgcttatctcagggagtatgagggcgagacgctgatgtgcgtcgcaaacctctcg
cggctgccccaggcggtcgagctcgacctctcggctttcgagggccgcgtaccgatcgaa
ttgaccggcatgtcgccctttccgccgatcggccagctgacctatctgctaacattgccg
ccctacggtttcttctggttccagctggaggccgatgccgacccaccggcatggcgcacc
gcgccgccggagcagcttcccgatctggtgacgatggtcatccgccgcggcctgctcgat
cttgtcgatgaacccaagcttgcgcgcaccctcagcaccgaaatcctgccggcctatctc
gcgaagcggcggtggttcggggcgaaagaccaggcgcttcaggcggcacgtctgatctcc
gcaacgccgatcccgtttgccgacggcatcgttctcggcgaattggaagccgtgctgccg
agccacagcgaatcctaccagctgccgctggcggttgcctgggacgatgcgcaaccgtcc
gcgctgacccagcagctggcactcggacggattcgccagggcaggcgcgtcggtttcctg
acggacggatttgccgtggaggcaatggcgcgtggcatcctgcgtgggcttggagaccgc
tcgcgcatcaccggccgcaccggcaccctcgaatttctcggcaccgagcggctcgaccgc
ctcgaagtcaccgacgaccttccggtccattggctctcggccgagcagtccaacagctcg
ctgattgtcggcgacctcgcgatgatcaagctgatcaggcacatctttcccggtattcat
ccggaggtcgagatgacgcgctatctgacgcgcgccggctatgaccacacggcgcccctg
ctcggcgaggtcgcgcatacggattccagcggacgccgttcgaccttgatcatcgtccag
ggcgcgatccgcaatcagggcgacgcctggaactggatgttgaacaatctgcgccgtggg
gcagacgaactcgtgctgaacgacccggctgtccaaccgggcgatgacgtctttcggccg
ttgatcagcttcgtcgcgatggtcggcctcaggctcggcgaactgcatgtcgtgctcgcc
ggggataccggggacgaggccttcagcccggtggtcgctggcgacagtgaggtcgaagcg
ataaagaaggcggttgccggcgaggtcgcctatgccctgtcgaagctcgacgaacgcgca
gagaatgccgatcccgccatcgacctgcttgcggcaccgcttctcgagcgccgctccgaa
ctcgtcgaactcgccgcgacgctggcggaaagcacccgtgatatgctgatgacgcgcacg
catggcgattttcatcttggccagatcctcgtcagcgaaggcgatgccgtcatcatcgac
ttcgagggcgagcccgcgaaaaacctgaccgagcgccgggccaagacaaacccgctgcgt
gatgtcgccgggcttttgagatcgctgaactacctcgtggccaccgcccagctcgataac
gacgcggtcatcgaacatgagaacgaagtccggcgcgaggcgatcgcccgcttcgggcgc
catgctgaggaggcctttctcgatgcctattcgcaggcggtctccgtatcgaaggagctt
gacatgccacccgatcaaagacggagggttctcgatgcctttcttctcgaaaaggccgcc
tatgagatcgcctatgaggcccgcaacaggccgaaatggcttccgatcccgctatccggc
tttaccgaaatcgtatcgcgtctggcgggggtcaaggcatga

DBGET integrated database retrieval system