KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_22050Help
Entry
RLEG3_22050       CDS       T03009                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rlb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RLEG3_22050
Enzymes [BR:rlb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RLEG3_22050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2352947..2353879
Genome map
AA seq 310 aa AA seqDB search
MKVGVSILGIFVADTAYLAKRMPNVGETITGTGFAVGPGGKGSNQAVAAARAGGTVSFIS
KIGRDTFGDMALKTYAEAGVTPKVVQMDDMPTGAAFIYVNDGNGDNAIIVYPGAAGTIGV
GDVEAARKTIEQSAVFVTQLEQPAEAAQRALEIAHAAGVTTVFNPAPAEPFPDTIYPLCD
YIVPNETEAAAIVGFPLDTLDDARRAGDAFLAKGVKAALITLGGRGVLYHTAGQSVHVPA
ISSGAVIDTTGAGDAFVGGFSAALSRGASPVEAVRFGCATAGIAVTRRGTAPAMPKIEEI
EALLEKGGAA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgggtgtttcgatcctcgggattttcgtcgccgacacggcctatctggccaag
cgcatgccaaacgttggcgagaccatcaccgggaccggttttgcagtagggccgggcggc
aagggatccaatcaggctgtcgctgctgcccgcgccggtggaacagtctccttcatctcg
aagatcggccgcgacacgttcggcgacatggcgctgaagacctatgcggaagcaggcgtg
acgccgaaggttgtgcagatggacgatatgccgaccggcgctgccttcatctacgtcaat
gatggtaacggcgacaatgcgattatcgtctatccaggtgccgcaggcaccatcggcgtt
ggcgatgtcgaggcggcacgcaaaaccatcgagcaatcggctgttttcgtgacccaactc
gaacaaccggccgaagcggcgcagcgcgccctcgaaatcgcccatgcggccggcgtcacc
actgttttcaatcctgcgccggccgagccgtttccagacacgatctatccgctctgtgac
tatatcgtgccaaacgaaaccgaagcagccgccatcgtaggttttccgctcgacacgctc
gatgacgccagacgggctggcgacgcctttcttgccaagggggtgaaagccgcgctgatc
accctgggtggtcgcggtgtgctctatcatacggccgggcaatcggttcatgttccggcg
atctcgtcgggagccgtcatcgataccaccggcgccggcgacgcatttgtcggtggcttc
tcggcagcgctctcgcggggcgctagtccggtcgaggccgtgcgtttcggctgcgcgacc
gctggtattgcggtgacgcggcggggtaccgcgcctgccatgccgaagatcgaagaaatc
gaggcgcttctcgagaaaggaggcgcagcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system