KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_32785Help
Entry
RLEG3_32785       CDS       T03009                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RLEG3_32785
   00650 Butanoate metabolism
    RLEG3_32785
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RLEG3_32785
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RLEG3_32785
Enzymes [BR:rlb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RLEG3_32785
Amino acid related enzymes [BR:rlb01007]
 Aminotransferase (transaminase)
  Class III
   RLEG3_32785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(4551766..4553046)
Genome map
AA seq 426 aa AA seqDB search
MTAISLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGRRYIDFAAGIAVLNTGHRHPR
VIAAVKDQLDRFTHTCHQVVPYESYVHLAERLNALLPGDFEKKTIFVTTGAEAVENAVKI
ARAATGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVFHIPFPVELHGVTAD
QSLAALKKLFAADVDPQRVAAIIIEPVQGEGGFYSAPAAFMKALRELCDQHGILLIADEV
QTGFARTGRMFAMDHHEVAPDLTTMAKSLAGGFPLAAVTGRAAIMDAPGPGGLGGTYGGN
PLGIAAAHAVLDVIVDEDLCNRANLLGGRLKQRLESLRETVPEIVDIRGPGFMNAVEFND
RTTGLPSAEFANRVRLIALDKGLILLTCGVHGNVIRFLAPITIQDEIFGEALDILEASML
QASAAK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgataagccttaccgaccggaagaacgccgctatttcacgcggcgtcggcatg
acgacccagatctatgcggatcgcgcagagaatgccgagatttgggacaaggagggccgc
cgctacatcgatttcgccgccggcatcgccgttctcaataccggccatcgccatccccgg
gtcatcgcagcggtcaaggatcagctcgaccgcttcacccatacctgccatcaggtggtg
ccctacgaaagctacgtccaccttgccgaacggctgaacgcgctgctgcctggtgatttc
gagaagaagacgatcttcgtcacgacgggcgccgaagcggtcgagaacgccgtcaagatc
gcgcgcgccgcaaccggccgctcggccgtcatcgcctttggcggcggcttccatggccgc
accttcatgggcatggcgctgaccggcaaggtcgtgccctacaaggtcggcttcggcgcg
atgcccggcgacgtgttccatattcccttcccggtcgagctgcacggcgtcaccgccgat
cagtcgctggcggcactgaagaagctcttcgccgccgatgtcgatccgcagcgcgtcgcg
gccatcatcatcgagccggtacagggcgaaggcggcttctactccgcacctgctgccttc
atgaaggcgctgcgcgagctctgcgaccagcacggcatcctgctgatcgccgacgaggtg
cagaccggttttgcacgcaccggcaggatgttcgcaatggatcatcacgaggtggcgccc
gacctgacgacgatggcaaagagcctggccggcggctttccgctcgccgccgtcaccggc
cgcgccgcgatcatggatgcgccgggaccgggcgggctcggcggcacctatggcggcaat
ccgcttgggatcgccgctgcccatgccgtgctcgacgtcattgtcgacgaggatctctgc
aaccgcgccaacctgctcggcggacggctgaagcagcggctggaatcattgcgcgagacg
gtgccggagatcgtcgatatccgcgggccgggcttcatgaacgccgtcgaattcaacgac
cggacgacgggactgccgagcgcggaattcgccaaccgggtgcggctgatcgcgctcgac
aagggcctgatcctgctcacctgcggcgtccacggaaacgtcatccgcttcctcgcgccg
atcaccatccaggacgagatcttcggcgaagcgctcgatattctcgaggcctccatgctg
caagcaagcgcggccaagtga

DBGET integrated database retrieval system