KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0021Help
Entry
RL0021            CDS       T00402                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rle01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rle00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rle00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
17640..18860
Genome map
AA seq 406 aa AA seqDB search
MNETPKPNSFRSGPDEDGRFGIYGGRFVAETLMPLILDLQDEWNRAKNDPAFQAELKHLG
AHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGSGTLKD
AMNEALRDWVTNVEDTYYLIGTAAGPHPYPEMVRDFQSVIGIEAKEQMLAAEGRLPDLVI
AAVGGGSNAIGIFHPFLDDPSVKIVGVEAGGKGLQGDEHCASITAGSPGVLHGNRTYLLQ
DSDGQIKEGHSISAGLDYPGIGPEHSWLNDTGRVDYVPIMDHEALEAFQTLTRLEGIIPA
LEPSHAIAEVIKRAPTMGKDEIILMNLSGRGDKDIFTVGKILGMGL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagacgcctaaaccgaattccttccgttccggccccgatgaagatggccgtttc
ggcatttatggcggtcgtttcgtggccgaaacgctgatgccgctgatcctcgacctgcag
gacgagtggaacagggcaaagaacgatccggcattccaggccgaattgaaacatctcggc
gcccattatatcggccgcccgagcccgctctatttcgccgagcggctgacagccgaactc
ggcggcgccaagatctatttcaagcgcgaagagctgaaccataccggctcgcacaagatc
aacaactgcatcggccagatcctgctcgccaagcgcatgggcaagacccgcatcatcgcc
gaaaccggtgctggccagcacggcgtcgcctccgcgaccgttgccgcccgctttggcctt
ccctgcgtcgtctatatgggcgccaccgacgtcgagcgtcaggcaccgaatgttttccgc
atgaagctgctcggcgcggaagtcaagccggtcacggcaggcagcggcacgctgaaggac
gccatgaacgaggcgcttcgcgactgggtcaccaatgtcgaggatacctattacctgatc
ggaacggcagccggtccgcatccctatccggagatggtccgcgatttccagtcggtgatc
ggcatcgaagcgaaagagcagatgctggcagccgaaggccgtcttccggatctcgtcatc
gctgccgtcggcggcggctcgaacgccatcggcattttccatcctttcctggatgatccc
tctgtcaagatcgtcggcgtcgaagccggcggcaagggtctgcagggcgacgaacattgc
gcctcgatcactgccggttcgccgggcgtgctgcacggcaaccgcacctacctgctgcag
gatagtgacggtcagatcaaggaaggccattcgatttcggccggtctcgattatcccggc
atcggccccgaacattcctggctgaatgataccggccgcgtcgactatgtgccgatcatg
gatcacgaagcgcttgaggctttccagaccctgacccgcctcgaaggcatcatcccggcg
ctcgagccctcgcatgcgattgccgaggtgattaaacgcgcaccgacgatgggcaaggac
gagatcatcctgatgaacctctccggccgcggcgacaaggatatcttcaccgtcggcaag
attctgggaatgggactgtaa

DBGET integrated database retrieval system