KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0022Help
Entry
RL0022            CDS       T00402                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RL0022 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RL0022 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RL0022 (trpA)
Enzymes [BR:rle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RL0022 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
18864..19703
Genome map
AA seq 279 aa AA seqDB search
MTARMDKRFAELKAEGRPALVTYFMGGDPDYDTSLGIMKALPEAGSDIIELGMPFSDPMA
DGPAIQLAGQRALKGGQTLKKTLQLAADFRKTNDATPIVMMGYYNPIYIYGVEKFLDDAL
LAGIDGLIVVDLPPEMDDELCIPAIRKGINFIRLATPTTDEKRLPKVLKNTSGFVYYVSM
NGITGSALPDPSLVSGAVERIKQHTKLPVCVGFGVKTAEHAKVIGGSADGVVVGTAIVNQ
VATSLTHDGKATADTVQAVATLVRGLSTGTRSARLVAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggacaaacgctttgccgagctgaaggccgagggccgtccggcgctt
gtgacctatttcatgggcggcgatcccgactacgacacctcgctcggcatcatgaaggcg
ctgccggaggcaggctccgacatcatcgagctcggcatgcccttttccgatccgatggcc
gacggcccggcgatccagctggccggccagcgcgcgctgaaaggcggccagacgctgaag
aagacgctgcagctggcggccgatttccgcaagaccaacgatgcgacgccgatcgtgatg
atgggttactacaacccgatctatatttacggcgtcgagaaattcctcgacgacgcgctc
ttagccggcatcgacggcctgatcgttgtcgacctgccacccgagatggatgacgagctc
tgcattccggcgatccgcaaaggcatcaatttcattcggttggcgacgccgacgacggat
gagaagcgcctgccgaaagtcctgaagaacacctcaggcttcgtctactacgtctcgatg
aacggcatcaccggttcggcgctgcctgatccgtcgttggtttcgggcgcggtcgagcgc
atcaagcagcacaccaagctgcccgtctgcgtcggcttcggcgtcaagacggcggaacac
gcaaaagtcatcggcggttcggccgacggcgtcgtcgtcggcaccgcgatcgtcaatcag
gtcgcgaccagcttgacgcatgacggaaaggcaacggccgacaccgttcaggcggttgcc
acgctggtgcgcggcctttccacaggaacacgttcggcgcgccttgttgctgccgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system