KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0046Help
Entry
RL0046            CDS       T00402                                 

Gene name
hisH
Definition
imidazole glycerol phosphate synthase subunit HisH
Orthology
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rle01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:rle00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(46921..47571)
Genome map
AA seq 216 aa AA seqDB search
MRVAIIDYGSGNLRSATKAFERAAHEAGIDAHIDLTDRAEDVAAADRIVLPGVGAYADCR
RGLDAVPDMAEVLIEAVEKKARPFLGICVGMQLMSSRGLEKTVTHGFGWIPGNVVEMTPD
DPALKIPQIGWNTLDLKRQHPLFEGIPTGSQGLHAYFVHSYHLAAENTEDVIATADYGGP
MTAFVGRDNMVGAQFHPEKSQKLGLALIANFLRWNP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgcgattatcgactatggctccggtaacctgcgctcggcgaccaaggctttc
gagcgtgccgcccacgaagctggcatcgatgcgcatatcgatctcaccgacagggcggag
gatgttgccgcagccgatcgtatcgtgcttcccggtgtcggcgcctatgccgattgccgg
cgcggcctcgatgccgtgcctgatatggccgaggtgctgatcgaggccgtcgagaagaag
gcgcggccgttcctcggcatctgcgtcggcatgcagctcatgtcctcgcgcggcctcgag
aagaccgtgacgcacggtttcgggtggattcccggtaacgtcgtcgagatgacgccggat
gatccggcactcaagatcccgcagatcggctggaacacgctcgacctgaagcgccaacat
ccgctcttcgaaggaattccgacggggtcgcagggactgcacgcctattttgtgcattcc
taccatcttgccgccgaaaacaccgaggatgttattgcgacggccgactatggcggtccg
atgaccgctttcgtcgggcgcgacaacatggtcggagcgcagtttcacccggaaaagagc
cagaagctcggcctggccctgatcgccaattttctgcgctggaacccgtag

DBGET integrated database retrieval system