KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0054Help
Entry
RL0054            CDS       T00402                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RL0054 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RL0054 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RL0054 (glcB)
Enzymes [BR:rle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RL0054 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
53965..56136
Genome map
AA seq 723 aa AA seqDB search
MSRVDKNGLAIETVLHDFLVEEVLPGLAVDADKFFADFSAIVHDLAPKNCALLAKRDELQ
VKIDDWYRRHGAPADMDEYQSFLREIGYLLPEGSDFQVSTQNVDPEIASIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPESDGAEKGKSYNPKRGEKVIAWVRDFLDTSAPL
QDCRWKDVGSFAVKDGALVVRSIDGEQAMLTDGKHFAGYRGDAAAPTHILLKNNGIHIEI
VIDAATTIGKADPAHISDVWLESAITTIMDCEDSIAAVDAEDKVVVYRNWLGLMKGDLQE
EVAKGGTSFIRTLNPDLQYAGPDGAAFEVHRRSLMLVRNVGHLMISPAILDRDGNEVPEG
IMDAAITGLIALYDIGPSGRRKNSRTGSMYVVKPKMHGPEEVAFAVEIFSRVEDALGLPR
NTIKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMR
QAAWISAYENWNVDIGLECGLAGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRVNVARVQQGLKDRARAKLSDILSVPVAVRPNWTPEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHKVVTEAQIIETMRR
MAAVVDRQNASDPAYQPMAGNFDDSIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAK
HTA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgttgataagaacggtcttgccatcgaaaccgtccttcatgatttcctcgtc
gaggaggtgctgccgggtctggcggtcgatgcggacaagttctttgccgatttttcggcg
atcgtccacgatctcgccccgaaaaattgtgcgttgctggcaaaacgcgacgagctgcag
gtgaagatcgacgattggtatcgtcggcatggcgccccggcggatatggacgaataccag
tccttccttcgcgaaatcggctatctcctgcctgagggatcggacttccaggtttcgacc
caaaatgtcgatccggagatcgcctcgatcgccggcccgcagctcgtcgttcccgtcatg
aacgcccgttacgccttgaacgccgccaatgcccgctggggctcgctctatgatgcgctc
tacggtacggacgccattcccgagagcgacggcgccgaaaagggcaagagctacaatccg
aagcgcggcgagaaggtcatcgcctgggtgcgcgatttcctcgatacatcagcgccgctg
caggactgccgctggaaggacgtcggaagcttcgccgtcaaggatggagcgctggtcgtc
agatcgatcgatggcgagcaggccatgctgacggacggcaagcattttgccggctatcgc
ggcgatgccgccgctccgacgcatattctcctgaagaacaacggcattcacatcgaaatc
gtcatcgatgcggcgacgacaatcgggaaagccgatccggctcatatttccgatgtctgg
ctggaatcggcaatcacgacgatcatggactgcgaggattcgattgccgccgtcgatgcc
gaggacaaagtcgtcgtctatcgcaactggctcggcctgatgaagggcgacctgcaggaa
gaggtggcaaagggcggaacgagcttcatccgcacgctcaacccggatctgcaatatgct
ggcccggatggtgccgccttcgaggtgcatcgccgctcgctgatgctggtgcgcaatgtc
ggccacctcatgatcagcccggcgatcctcgaccgcgacggcaacgaggtgcctgaaggc
atcatggatgctgcgatcaccggcctgatcgcgctttacgatatcggcccctccggccgg
cggaagaattcccgcaccggctccatgtatgtggtcaagccgaagatgcatgggccggaa
gaggtagccttcgccgtcgaaatcttctcgcgggtcgaagatgcgcttggcctaccgcgc
aacaccatcaagatgggcatcatggatgaggagcgccgcacgaccgtcaacctcaaggag
tgcatccgtgccgcccgcgagcgcgttgtcttcatcaataccggcttcctcgatcgcacc
ggcgacgagatccacacctcgatggaagccggcccgatgattcgcaagggcgacatgcgc
caggcggcgtggatttccgcctatgagaactggaacgtcgacatcggcctcgaatgcggc
cttgccggccacgcccagatcggcaagggcatgtgggcgatgccggatctgatggcggcg
atgctcgaacagaagatcgcccacccgaaggccggcgccaacaccgcctgggtaccgtcg
ccgacggccgcaaccctgcatgccacccattatcaccgggtcaatgtcgctcgcgtccag
caggggctgaaggatcgcgcccgcgccaagctctccgatattctctccgtgccggttgcg
gtgcggccgaactggacgccggaggaaatccagcgcgaactcgacaacaatgcccagggc
atcctcggctatgtcgtgcgctgggtcgatcagggcgtcggctgctcgaaggtgcccgac
atcaacaatgtcggcttgatggaagatcgcgcgacgctgcgcatttcggcccagcacatg
gcgaactggctgcatcacaaggtcgtcaccgaagctcagatcatcgagacgatgaggcgc
atggccgccgtcgtcgaccggcagaatgcgtcggaccccgcctatcagccgatggccggt
aatttcgacgattcgatcgccttccaggctgccctcgatctcgtcctgaagggtagggaa
cagccgaacggttataccgagccggtgcttcaccgccgccgcctcgagctcaaggcgaag
cacactgcctga

DBGET integrated database retrieval system