KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0054Help
Entry
RL0054            CDS       T00402                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RL0054 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RL0054 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RL0054 (glcB)
Enzymes [BR:rle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RL0054 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
53965..56136
Genome map
AA seq 723 aa AA seqDB search
MSRVDKNGLAIETVLHDFLVEEVLPGLAVDADKFFADFSAIVHDLAPKNCALLAKRDELQ
VKIDDWYRRHGAPADMDEYQSFLREIGYLLPEGSDFQVSTQNVDPEIASIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPESDGAEKGKSYNPKRGEKVIAWVRDFLDTSAPL
QDCRWKDVGSFAVKDGALVVRSIDGEQAMLTDGKHFAGYRGDAAAPTHILLKNNGIHIEI
VIDAATTIGKADPAHISDVWLESAITTIMDCEDSIAAVDAEDKVVVYRNWLGLMKGDLQE
EVAKGGTSFIRTLNPDLQYAGPDGAAFEVHRRSLMLVRNVGHLMISPAILDRDGNEVPEG
IMDAAITGLIALYDIGPSGRRKNSRTGSMYVVKPKMHGPEEVAFAVEIFSRVEDALGLPR
NTIKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMR
QAAWISAYENWNVDIGLECGLAGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRVNVARVQQGLKDRARAKLSDILSVPVAVRPNWTPEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHKVVTEAQIIETMRR
MAAVVDRQNASDPAYQPMAGNFDDSIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAK
HTA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgttgataagaacggtcttgccatcgaaaccgtccttcatgatttcctcgtc
gaggaggtgctgccgggtctggcggtcgatgcggacaagttctttgccgatttttcggcg
atcgtccacgatctcgccccgaaaaattgtgcgttgctggcaaaacgcgacgagctgcag
gtgaagatcgacgattggtatcgtcggcatggcgccccggcggatatggacgaataccag
tccttccttcgcgaaatcggctatctcctgcctgagggatcggacttccaggtttcgacc
caaaatgtcgatccggagatcgcctcgatcgccggcccgcagctcgtcgttcccgtcatg
aacgcccgttacgccttgaacgccgccaatgcccgctggggctcgctctatgatgcgctc
tacggtacggacgccattcccgagagcgacggcgccgaaaagggcaagagctacaatccg
aagcgcggcgagaaggtcatcgcctgggtgcgcgatttcctcgatacatcagcgccgctg
caggactgccgctggaaggacgtcggaagcttcgccgtcaaggatggagcgctggtcgtc
agatcgatcgatggcgagcaggccatgctgacggacggcaagcattttgccggctatcgc
ggcgatgccgccgctccgacgcatattctcctgaagaacaacggcattcacatcgaaatc
gtcatcgatgcggcgacgacaatcgggaaagccgatccggctcatatttccgatgtctgg
ctggaatcggcaatcacgacgatcatggactgcgaggattcgattgccgccgtcgatgcc
gaggacaaagtcgtcgtctatcgcaactggctcggcctgatgaagggcgacctgcaggaa
gaggtggcaaagggcggaacgagcttcatccgcacgctcaacccggatctgcaatatgct
ggcccggatggtgccgccttcgaggtgcatcgccgctcgctgatgctggtgcgcaatgtc
ggccacctcatgatcagcccggcgatcctcgaccgcgacggcaacgaggtgcctgaaggc
atcatggatgctgcgatcaccggcctgatcgcgctttacgatatcggcccctccggccgg
cggaagaattcccgcaccggctccatgtatgtggtcaagccgaagatgcatgggccggaa
gaggtagccttcgccgtcgaaatcttctcgcgggtcgaagatgcgcttggcctaccgcgc
aacaccatcaagatgggcatcatggatgaggagcgccgcacgaccgtcaacctcaaggag
tgcatccgtgccgcccgcgagcgcgttgtcttcatcaataccggcttcctcgatcgcacc
ggcgacgagatccacacctcgatggaagccggcccgatgattcgcaagggcgacatgcgc
caggcggcgtggatttccgcctatgagaactggaacgtcgacatcggcctcgaatgcggc
cttgccggccacgcccagatcggcaagggcatgtgggcgatgccggatctgatggcggcg
atgctcgaacagaagatcgcccacccgaaggccggcgccaacaccgcctgggtaccgtcg
ccgacggccgcaaccctgcatgccacccattatcaccgggtcaatgtcgctcgcgtccag
caggggctgaaggatcgcgcccgcgccaagctctccgatattctctccgtgccggttgcg
gtgcggccgaactggacgccggaggaaatccagcgcgaactcgacaacaatgcccagggc
atcctcggctatgtcgtgcgctgggtcgatcagggcgtcggctgctcgaaggtgcccgac
atcaacaatgtcggcttgatggaagatcgcgcgacgctgcgcatttcggcccagcacatg
gcgaactggctgcatcacaaggtcgtcaccgaagctcagatcatcgagacgatgaggcgc
atggccgccgtcgtcgaccggcagaatgcgtcggaccccgcctatcagccgatggccggt
aatttcgacgattcgatcgccttccaggctgccctcgatctcgtcctgaagggtagggaa
cagccgaacggttataccgagccggtgcttcaccgccgccgcctcgagctcaaggcgaag
cacactgcctga

DBGET integrated database retrieval system