KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0066Help
Entry
RL0066            CDS       T00402                                 

Definition
(GenBank) putative xylulose-5-phosphate phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00030  Pentose phosphate pathway
rle01100  Metabolic pathways
rle01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RL0066
Enzymes [BR:rle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     RL0066
    4.1.2.22  fructose-6-phosphate phosphoketolase
     RL0066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: CAK05554
GeneDB: RL0066
RhizoBase: RL0066
UniProt: Q1MN98
Position
complement(82152..84617)
Genome map
AA seq 821 aa AA seqDB search
MVSLKTARDAKVALHAKMATGGPLSTEELQSIDAYWRASNYLSVGQIYLLDNPLLKEPLR
REHIKPRLLGHWGTSPGLNMLYVHLNRVIKRDDLEMIYVIGPGHGGPSLVAHAYLEGTYS
EVYPNISQDAEGMKRLFKQFSFPGGIPSHVAPETPGSIHEGGELGYALSHAYGAAFDNPN
LIVACVVGDGEAETGPLATGWHGNKFLNPARDGCVLPILHLNGYKIANPCFLARIPRDEL
RKFFEGMGYTPYFVEGSDPENVHQQLAGVLDTAVADIQEIWATARTKGKIKRPMWPMIIF
RTPKGWTCPPEIDGKKCEDYWRAHQVPMGDMDKPEHIRILQEWMKSYRPEELFDDSGRFK
PGLAALAPVGQRRMSDNPHANGGLLLRDLKMPDFRDYAVSVPSPGQTHTEAARVMGKFLR
DIMKMNMDSKNFRLFSPDENNSNRWQDVLEVTDRCYMADIYPEDDHLSPDGRVMEVLSEH
QCQGWLEGYLLTGRHGFFSCYEAFIHIIDSMFNQHAKWLKVCNDIPWRRSVASLNYFLSS
HVWRQDHNGFSHQDPGFIDHVVNKKADVVRIYLPPDANTLLSVTDHCLRSRNYVNVVVAG
KQPAPQWLTMDQAIKHCSEGLGIWEWASNDKGSEPDVVMACCGDVPTLETLAAVELIREH
LPELKVRVINVVNLMKLQPPSEHPHGLPDRDFDALFTKNKPIIFAFHGYPWLIHRLTYRR
TNHGNLHVRGYKEEGTTTTPFDMVVLNEMDRFHLVEDVIDRLPQLGARAAYFKQAIREKL
VEHRQYIEKYGDDMPAISGWKWGSKAQPKTRQRTSTEGDNA
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgctcaagacggcacgagatgcaaaggtcgccctacacgcgaagatggcaacg
ggcggccccctttcgacggaagaattgcagtccatcgacgcctattggcgcgcatcgaac
tatctgtcggtcggacagatttatcttctcgacaatccactgctgaaagaaccattgagg
cgcgagcacataaagccgcgactgcttggccattggggcacgtcgccgggtttgaacatg
ctttacgtgcatctcaaccgcgtgatcaaacgcgatgatcttgagatgatctacgtcatc
ggaccaggacatggcggaccgtcgctggttgcgcacgcctatctcgaaggcacctacagc
gaagtttatcccaatataagtcaggatgccgagggcatgaagaggctgttcaagcagttc
agcttccccggcggcatccctagccacgttgccccggaaacccccggcagtatccacgag
ggcggcgaactgggttatgccctcagccacgcctatggggcggcgttcgacaacccgaat
ctgattgtcgcctgcgtcgtcggcgacggggaggccgaaaccgggccgcttgcaacaggc
tggcacggcaacaaattcctcaatcccgctcgcgacggctgcgtgctgccgatcctgcat
ctgaacggctacaagatcgccaacccgtgcttcctcgcccgcattccccgggacgaactg
aggaagttcttcgaaggcatgggctacacgccgtatttcgtcgagggtagcgaccctgaa
aacgtgcaccagcaattggccggcgtgctcgacacagcagtggcggatatccaggaaatc
tgggcaacagcccgcaccaaaggcaagataaaacgcccgatgtggccgatgatcattttc
cgcacgccaaagggctggacctgcccccccgagatcgacggcaagaagtgcgaggattac
tggcgggcgcaccaggtgccgatgggcgacatggacaaaccggagcacatccgcattctg
caggaatggatgaagagctaccgccctgaggaattgtttgatgacagcggtcgcttcaag
ccagggctggcggcgctggcgcccgtggggcaacgccgaatgagcgacaatccgcatgcc
aacggcggattgctattgcgggacctgaaaatgcccgacttccgggactacgcggtatcc
gttccaagccccgggcaaacacacactgaggccgcgcgggtgatgggcaagtttctccgc
gatatcatgaagatgaacatggacagcaagaacttccgactgttcagccccgatgagaac
aactccaatcgctggcaggatgtactggaggtcaccgaccgctgctacatggcggatatc
tatccggaagacgatcatctttcgcccgatggcagagtgatggaggtgctcagcgagcat
caatgccaaggctggctggaaggttacctgctgaccggccggcatggcttcttttcctgc
tacgaagctttcatccatatcatcgactcgatgttcaaccagcacgccaaatggctgaag
gtgtgcaacgacattccatggcggcgatcggtcgcctcgcttaactatttcctgagttcc
cacgtctggcggcaggaccacaatggctttagccatcaggacccggggttcatcgatcac
gtggtcaacaagaaggcggatgttgtccggatctacctgccgccggacgccaatacattg
ctctctgtaaccgatcactgcttgcgcagccgcaactatgtcaacgtggttgtcgcaggc
aagcagccagccccgcagtggctgacgatggatcaggccatcaagcattgcagcgaaggt
ctcggcatttgggaatgggccagcaatgacaagggaagcgaacctgacgttgtgatggca
tgttgtggggatgttccaacgcttgagacgctggcggcggtcgagctaatccgggagcac
ctgccggagctgaaagttcgtgttatcaacgtcgtgaacctgatgaaacttcaacccccg
tccgagcatccacatgggctgccggatcgcgattttgatgcgctgttcaccaagaacaag
ccgatcatcttcgccttccacggctatccgtggctcatccaccggctcacctaccgccgt
accaatcacggcaatctgcacgtccgcggctacaaggaagaaggaacgacgacgacgccg
ttcgacatggtggtcctgaatgaaatggaccgcttccatctggtcgaggacgtcatcgac
cggctgccgcaactcggtgcacgcgctgcatatttcaagcaggcaattcgcgagaagctg
gtcgaacatcgccaatatattgagaagtatggcgacgacatgccggcaatcagcggctgg
aaatggggctcgaaagctcagccaaaaacacgtcaaaggacctccaccgaaggggacaat
gcttga

DBGET integrated database retrieval system