KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0066Help
Entry
RL0066            CDS       T00402                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rle00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(82152..84617)
Genome map
AA seq 821 aa AA seqDB search
MVSLKTARDAKVALHAKMATGGPLSTEELQSIDAYWRASNYLSVGQIYLLDNPLLKEPLR
REHIKPRLLGHWGTSPGLNMLYVHLNRVIKRDDLEMIYVIGPGHGGPSLVAHAYLEGTYS
EVYPNISQDAEGMKRLFKQFSFPGGIPSHVAPETPGSIHEGGELGYALSHAYGAAFDNPN
LIVACVVGDGEAETGPLATGWHGNKFLNPARDGCVLPILHLNGYKIANPCFLARIPRDEL
RKFFEGMGYTPYFVEGSDPENVHQQLAGVLDTAVADIQEIWATARTKGKIKRPMWPMIIF
RTPKGWTCPPEIDGKKCEDYWRAHQVPMGDMDKPEHIRILQEWMKSYRPEELFDDSGRFK
PGLAALAPVGQRRMSDNPHANGGLLLRDLKMPDFRDYAVSVPSPGQTHTEAARVMGKFLR
DIMKMNMDSKNFRLFSPDENNSNRWQDVLEVTDRCYMADIYPEDDHLSPDGRVMEVLSEH
QCQGWLEGYLLTGRHGFFSCYEAFIHIIDSMFNQHAKWLKVCNDIPWRRSVASLNYFLSS
HVWRQDHNGFSHQDPGFIDHVVNKKADVVRIYLPPDANTLLSVTDHCLRSRNYVNVVVAG
KQPAPQWLTMDQAIKHCSEGLGIWEWASNDKGSEPDVVMACCGDVPTLETLAAVELIREH
LPELKVRVINVVNLMKLQPPSEHPHGLPDRDFDALFTKNKPIIFAFHGYPWLIHRLTYRR
TNHGNLHVRGYKEEGTTTTPFDMVVLNEMDRFHLVEDVIDRLPQLGARAAYFKQAIREKL
VEHRQYIEKYGDDMPAISGWKWGSKAQPKTRQRTSTEGDNA
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgctcaagacggcacgagatgcaaaggtcgccctacacgcgaagatggcaacg
ggcggccccctttcgacggaagaattgcagtccatcgacgcctattggcgcgcatcgaac
tatctgtcggtcggacagatttatcttctcgacaatccactgctgaaagaaccattgagg
cgcgagcacataaagccgcgactgcttggccattggggcacgtcgccgggtttgaacatg
ctttacgtgcatctcaaccgcgtgatcaaacgcgatgatcttgagatgatctacgtcatc
ggaccaggacatggcggaccgtcgctggttgcgcacgcctatctcgaaggcacctacagc
gaagtttatcccaatataagtcaggatgccgagggcatgaagaggctgttcaagcagttc
agcttccccggcggcatccctagccacgttgccccggaaacccccggcagtatccacgag
ggcggcgaactgggttatgccctcagccacgcctatggggcggcgttcgacaacccgaat
ctgattgtcgcctgcgtcgtcggcgacggggaggccgaaaccgggccgcttgcaacaggc
tggcacggcaacaaattcctcaatcccgctcgcgacggctgcgtgctgccgatcctgcat
ctgaacggctacaagatcgccaacccgtgcttcctcgcccgcattccccgggacgaactg
aggaagttcttcgaaggcatgggctacacgccgtatttcgtcgagggtagcgaccctgaa
aacgtgcaccagcaattggccggcgtgctcgacacagcagtggcggatatccaggaaatc
tgggcaacagcccgcaccaaaggcaagataaaacgcccgatgtggccgatgatcattttc
cgcacgccaaagggctggacctgcccccccgagatcgacggcaagaagtgcgaggattac
tggcgggcgcaccaggtgccgatgggcgacatggacaaaccggagcacatccgcattctg
caggaatggatgaagagctaccgccctgaggaattgtttgatgacagcggtcgcttcaag
ccagggctggcggcgctggcgcccgtggggcaacgccgaatgagcgacaatccgcatgcc
aacggcggattgctattgcgggacctgaaaatgcccgacttccgggactacgcggtatcc
gttccaagccccgggcaaacacacactgaggccgcgcgggtgatgggcaagtttctccgc
gatatcatgaagatgaacatggacagcaagaacttccgactgttcagccccgatgagaac
aactccaatcgctggcaggatgtactggaggtcaccgaccgctgctacatggcggatatc
tatccggaagacgatcatctttcgcccgatggcagagtgatggaggtgctcagcgagcat
caatgccaaggctggctggaaggttacctgctgaccggccggcatggcttcttttcctgc
tacgaagctttcatccatatcatcgactcgatgttcaaccagcacgccaaatggctgaag
gtgtgcaacgacattccatggcggcgatcggtcgcctcgcttaactatttcctgagttcc
cacgtctggcggcaggaccacaatggctttagccatcaggacccggggttcatcgatcac
gtggtcaacaagaaggcggatgttgtccggatctacctgccgccggacgccaatacattg
ctctctgtaaccgatcactgcttgcgcagccgcaactatgtcaacgtggttgtcgcaggc
aagcagccagccccgcagtggctgacgatggatcaggccatcaagcattgcagcgaaggt
ctcggcatttgggaatgggccagcaatgacaagggaagcgaacctgacgttgtgatggca
tgttgtggggatgttccaacgcttgagacgctggcggcggtcgagctaatccgggagcac
ctgccggagctgaaagttcgtgttatcaacgtcgtgaacctgatgaaacttcaacccccg
tccgagcatccacatgggctgccggatcgcgattttgatgcgctgttcaccaagaacaag
ccgatcatcttcgccttccacggctatccgtggctcatccaccggctcacctaccgccgt
accaatcacggcaatctgcacgtccgcggctacaaggaagaaggaacgacgacgacgccg
ttcgacatggtggtcctgaatgaaatggaccgcttccatctggtcgaggacgtcatcgac
cggctgccgcaactcggtgcacgcgctgcatatttcaagcaggcaattcgcgagaagctg
gtcgaacatcgccaatatattgagaagtatggcgacgacatgccggcaatcagcggctgg
aaatggggctcgaaagctcagccaaaaacacgtcaaaggacctccaccgaaggggacaat
gcttga

DBGET integrated database retrieval system