KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0081Help
Entry
RL0081            CDS       T00402                                 

Definition
(GenBank) putative polysaccharide degradation protein
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00500  Starch and sucrose metabolism
rle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RL0081
Enzymes [BR:rle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RL0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_26 FlgM
Motif
Other DBs
NCBI-ProteinID: CAK05569
GeneDB: RL0081
RhizoBase: RL0081
UniProt: Q1MN83
Position
103715..104686
Genome map
AA seq 323 aa AA seqDB search
MKKLMKKNLSTAAIALLLLCVADLPGRSEVQYAGIAPNPAAAVRTIIDKRPVLHADGIKF
GAYDPHGDFGAQASVATEALFLPWEDVDLETLRVADAYAQARGRNLLITVEPWSWDVDWR
LTSAELRAKVLRGDYDVNMRAIAQMISELKSPVIVRWGQEMEDKSGRFSWSGWSPQDYIT
AYKRMMDIVRQEAPGTELMWSPKGEPGLQAYYPGDDYVDLVGLSVFGLQRYDELAYNGHR
TFSEALKQGYDLVAGYGKPIWVAELGYGGGDAYMKPWIETVALKQSAFPNLQEVVYFNDR
DVHAWPFDLGRPDWRVVESLANR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctgatgaaaaaaaacctctcgaccgccgcgatagcgctgctgctactgtgt
gtcgcggatctgccgggccgaagcgaagtgcaatatgccggcattgccccgaacccggcg
gcggccgtgcggacgatcatcgacaagcgccccgtgcttcatgccgacggcatcaagttc
ggtgcctacgatccgcacggcgatttcggcgcccaggcgagtgtcgcgaccgaagccctg
ttcctgccatgggaggacgtcgatctcgagacgctgcgtgtcgccgatgcctatgcgcag
gccagaggccgcaacctgctgatcactgtggagccatggtcctgggacgtcgattggcgg
ctgacctccgcggagcttcgcgcaaaggtcctgcgcggtgattatgatgtcaacatgcgt
gcgatcgcgcagatgatatctgagctgaaaagcccggtgatcgtccgctggggacaggag
atggaggacaagtcagggcggttttcatggtccggctggagcccgcaggactatatcacg
gcctacaagcggatgatggacattgtccgccaagaggcgcccggcaccgagctcatgtgg
tcgccgaagggagagcctggcctccaggcctattatcccggcgacgattatgtcgatctc
gtcgggctctcggtcttcggcctgcagcgctacgacgagcttgcctacaatgggcaccgc
accttctcggaagcgctgaagcagggatatgatctcgtcgccggctacggaaagcccatc
tgggtggcggagctcggctatggaggcggcgacgcctatatgaagccgtggatcgaaacg
gttgcgttgaagcagagcgccttcccgaatctgcaggaggtggtctatttcaacgatcgg
gatgtgcacgcctggcccttcgatctcggtcggccggactggcgcgtggtcgaaagtctg
gctaaccgatag

DBGET integrated database retrieval system