KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0131AHelp
Entry
RL0131A           CDS       T00402                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rle03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(162809..163414)
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLIKKKDQLLGPLSHAMGEAYDKVKIC
SRCGNVDTVDPCIVCTDVQRDQSVIIVVEDVSDLWALERAGAMNAAYHVLGGTLSPLDGV
GPDDLNIRGLIDRVGEGGIRELIIAVNATVEGQTTAHYITDQLQGLDVKITRLAHGVPVG
GELDYLDEGTLAAALRARTVI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgagtcaccggccccgaaatcgaaaaactcatccagcttctggcgaaggtg
ccgggcctcgggccgcgttcggcgcgccgggcggcactgcatctgatcaagaagaaggac
cagttgctcggcccgctgtcgcatgcaatgggcgaggcctatgacaaggtgaagatctgc
tcgcgctgcggcaatgtcgatacggtcgatccctgtattgtctgcaccgacgtccaacgc
gatcaatccgtcatcatcgtcgtcgaggacgtatcggatctctgggcgctggagcgggca
ggcgcgatgaacgccgcctatcacgtgctcggcggcacgctgtcgccgctcgacggggtc
ggtccagacgatctcaatattcgcggcctgatcgaccgggtcggcgaaggcggcatccgg
gaactgatcatcgcggtcaacgccaccgtcgagggacagacgacggcgcattacatcacc
gaccagctgcaggggctcgacgtgaagatcacgcggctggcgcatggcgtgcccgtcggc
ggcgagctcgactatctcgacgagggcacgcttgcggcggcacttcgagcgcggacggtg
atatga

DBGET integrated database retrieval system