KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0141Help
Entry
RL0141            CDS       T00402                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rle00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rle02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
171429..171992
Genome map
AA seq 187 aa AA seqDB search
MNSYVNTAVGALLGTIFVLMSVSIASEGIFHSEAPEKEGFAIVAEEAPAAGGEAAPAVAV
PIAQLLASADAKAGETVFKKCQACHDGTKGGPNKVGPNLFGVVDRPIASHAGFAYSAPMK
DFSKGGSEKWTFEYLNKFLLAPKKDIPGTAMGFAGLAKDQERANVILYLHTLADSPGPLP
DPNAATQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatacgtcaatacggccgtcggggcgctgctcggaacgattttcgttctgatg
tctgtctccatcgcgtccgaggggatcttccattccgaagcaccggaaaaggaaggtttc
gcgatcgttgccgaagaggcgcccgccgctggcggcgaggctgcgcctgccgttgccgtt
ccgatcgcgcaattgctcgcttctgcagatgccaaggccggtgaaactgtcttcaagaag
tgtcaggcctgtcatgacggcaccaaagggggaccgaacaaggtcggtcccaacctcttt
ggtgtcgtagatcgcccgatcgcctcgcatgcaggcttcgcctattccgctcccatgaag
gatttctccaagggtggcagcgagaagtggaccttcgaatatctcaacaagttcctgctg
gcgccaaagaaggacattccgggcaccgccatgggcttcgccggtctggcgaaggatcag
gagcgcgccaacgtcatcctctacctgcacacgcttgccgattcgccgggaccgctgccg
gatccgaacgccgcgacgcagtaa

DBGET integrated database retrieval system