KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0182Help
Entry
RL0182            CDS       T00402                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RL0182 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RL0182 (glk)
   00052 Galactose metabolism
    RL0182 (glk)
   00500 Starch and sucrose metabolism
    RL0182 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RL0182 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RL0182 (glk)
   00524 Butirosin and neomycin biosynthesis
    RL0182 (glk)
Enzymes [BR:rle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RL0182 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(217115..218140)
Genome map
AA seq 341 aa AA seqDB search
MSKPNNSTAPLPFPILIGDIGGTNARFSILTDAYAEPKQFPNVRTADFATIDEAIQQGVL
DKTAVQPRSAILAVAGPINDDEIPLTNCDWVVRPKTMIEGLGMEDVLVVNDFEAQALAIA
ALSDENRERIGDATRDMIASRVVLGPGTGLGVGGLVHAQHSWIPVPGEGGHVDLGPRSKR
DYDIFPHIETIEGRVSAEQILCGRGLVNLYHAICVVDGIEPTMKDPADITSHALAGSDKA
AVETVSLFATYLGRVAGDLAMVFMARGGVYLSGGISQKIIPALKKPEFRIAFEDKAPHTA
LLRTIPTYVVTHPLAALAGLSSYARMPANFGVSTEGRRWRR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaccgaacaacagcaccgctccgctgcctttcccgatcctgatcggcgatatc
ggcggcacgaatgcccgcttctccatcctgaccgatgcctatgctgaaccgaagcagttt
ccgaacgtgcgcacggcggatttcgcgacgatcgacgaagcgatccagcaaggcgtgctc
gacaagaccgccgtgcagccgcgctcggcgatcctcgccgtcgccggcccgatcaacgac
gacgagatcccgctgaccaattgcgactgggtggtgcggccgaagacgatgatcgagggc
ctcggcatggaggatgtgctcgtcgtcaacgatttcgaggcgcaggcgctggcaatcgcc
gcgctttcggatgaaaatcgcgaacggatcggcgacgctacccgcgacatgatcgcctcc
cgcgtcgtactcggaccgggcaccggcctcggcgtcggcgggctcgtgcatgcccagcac
agctggatcccggttcccggcgaaggcggccatgtcgatctcgggccgcgcagcaagcgc
gattatgacatcttcccgcatatcgagacgatcgaaggccgcgtttcggccgagcagatc
ctctgcgggcgcggcctcgtcaacctctatcatgccatctgcgtggtcgatggcatcgag
ccgacgatgaaggatcccgccgacatcacctcgcacgcacttgccggcagcgacaaggca
gccgtagagaccgtctcgctgtttgccacctatctcggccgcgtggcgggcgacttggcg
atggtgttcatggcgcggggcggcgtctatctttccggcggcatctcgcagaagatcatc
ccggcgctgaagaagccggaattccgcatcgccttcgaggacaaggcgccgcatacggcg
ctgcttcggaccatcccgacctatgtggtgacacatccgctggcagcgcttgccgggctt
tcctcctatgcgcgcatgccggcgaatttcggcgtctcgacggaaggccgccgctggcgc
cgctaa

DBGET integrated database retrieval system