KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0203Help
Entry
RL0203            CDS       T00402                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RL0203 (deoA)
Enzymes [BR:rle01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RL0203 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
238765..240072
Genome map
AA seq 435 aa AA seqDB search
MIPQEIIRRKRDGDELDAAEISSFIAALAAGQLSEGQIGAFAMAVWFKGMSRTETVALTL
AMADSGDRLQWADVDRPIADKHSTGGVGDNVSLMLAPIAAACGLAVPMISGRGLGHTGGT
LDKLESIPGYMITPDADLFHKVVKEAGCAIIGQTGTLAPADGRLYAVRDVTATVDSIPLI
TASILSKKLAAGLETLVLDVKVGNGAFMVDRGQAETLAQSLVEVANGAGVKTSALITDMN
QPLADSAGNAVEMRNCLDFLAGRKADTRLETVVLAFAAEMLVKSGIAASSDEAEGMARRA
LSSGKAAEVFARMVSMLGGPADLIENPDRYLARAPVAKPVPAARSGWLAACDARGIGVSV
IDLGGGRRHPADRIDHRVGFSELLPLGTRVNAGEPIALVHAADDAAAERAVAALAAHYRI
TEEKPELTPVIAGLI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattccgcaggagatcatccggcgtaagcgcgatggcgacgaactcgacgccgccgag
atcagctccttcatcgctgcgttggctgccggtcagttgtcggaaggccagatcggcgca
ttcgccatggccgtctggttcaagggcatgtcgcggaccgaaaccgtggccttgacgctg
gcgatggccgattccggcgacaggctgcaatgggccgatgtcgatcgcccgatcgccgac
aaacattcgaccggcggcgtcggcgacaatgtttcgctgatgctggcgccgatcgccgcc
gcctgcggcctcgccgttccgatgatctccggacgcggcctcggccacaccggcggcacg
ctggataagctcgaatccattcccggctatatgatcaccccggatgcggatctgttccac
aaggtcgtgaaggaggcgggatgcgccatcatcggccagaccgggaccttggcgcccgcc
gacggcaggctctatgccgtgcgcgacgtaaccgccaccgtcgattccattcccctcatc
accgcctccatcctctcgaagaaacttgcggccgggctcgagacattggtgctcgacgtc
aaggtcggcaacggcgctttcatggtggaccgcggccaggcggagactctggcgcagtcg
ctggtcgaggtggccaatggcgcaggcgtgaagacctcggcactgatcaccgacatgaac
cagccgctcgccgatagtgccggcaacgctgtcgagatgcgcaactgcctggatttcctg
gcaggccgaaaggccgacacgcggcttgagaccgtcgttcttgccttcgccgccgaaatg
ctggtgaaatcgggtatcgccgcctcgtctgatgaagccgagggaatggcgcgtcgggcg
ctgtcatcgggaaaggcggccgaggtcttcgcgcgcatggtgtccatgctcggcggcccg
gccgatctgatcgaaaaccccgaccggtacctggccagggcgccggtcgcaaagcctgtt
ccggccgcccggtccggctggcttgccgcctgcgatgcgcgcggtatcggcgtcagtgtc
atcgatctcggcggcggaagacgccatccggcggaccggatcgatcatcgcgtcggcttt
tccgaactcctgccgctcggcacccgggtcaatgccggcgaaccgatcgcgctggttcat
gccgccgacgacgccgcggcggagagagcagttgcggcacttgccgcgcactaccgcatc
acagaggagaagccggagctgacaccggtgattgcgggcctgatctga

DBGET integrated database retrieval system