KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0236Help
Entry
RL0236            CDS       T00402                                 

Definition
carboxymethyl cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RL0236
Enzymes [BR:rle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RL0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(274119..275201)
Genome map
AA seq 360 aa AA seqDB search
MLRFAAIARMPMKTTRHLTALLLAAALIPSPALAAEAPCYRGVNLSGGEYGERGGIYGTN
YTYPSEDTIGYFAEKGMTIIRLPFRWERLQPALGGRLDEDELKRIKDTIGLIRKHGMAVL
LDPHNFGYYDKTQVGTAPATDAAFGDFWARLAVEFANQDGVLFGLMNEPHDIKATDWLDA
ANAAIRSIRAVGARNLILVPGTAWSGAGSWEKDVIGGANGTVMLGVRDPLDFYAYEVHQY
LDADSSGTHPTCEGAGAAVAAINGVTAWLKQNHKRGFLGEFGASADKDCMSGLTEIYATM
SDNSDVWLGWSYWAAGDWWPANEPFNVQPRKGPERPQMRLLAEVAKAGAGTCSAVKPAGK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgatttgccgcgatagcgaggatgcccatgaagacgacacgacatctgacagcg
ctgctgcttgcggccgctctcatcccgtcgccggcccttgcggctgaggccccctgctac
cgtggcgtcaatttgtccggcggcgaatatggcgaacgcggcggcatctacggcaccaat
tacacctatccgagcgaagacacgattggctatttcgccgaaaaaggcatgacgatcatc
cggctgcccttccgctgggaacggctgcagccggccctcggcgggcggctcgacgaggat
gagctcaagcggatcaaagatacgatcggcctgatccgcaaacacggcatggcggttctg
ctcgacccgcataatttcggctactacgacaagactcaggtcggcacggcgccggcaaca
gatgccgccttcggtgatttctgggcaaggctcgctgtcgaattcgccaatcaggacggc
gttctcttcggcctgatgaacgaaccgcacgacatcaaggcaacggattggctggatgcc
gccaatgccgcgatccgcagcatccgcgccgtcggcgcccgcaacctcatcctggtgccg
ggcaccgcatggagcggcgcgggcagctgggaaaaggacgtgatcggcggcgccaacggc
acggtgatgctcggcgtgcgcgatccgctcgacttctacgcctatgaggtccaccagtat
ctcgacgccgattcctccggaacccatccgacctgcgaaggtgccggcgccgcggtcgcc
gcgatcaacggcgttaccgcctggctgaagcagaaccacaagcgcggctttctcggcgaa
ttcggcgcctccgccgacaaggactgcatgagcgggttgaccgaaatctacgccaccatg
tctgataatagcgacgtctggctcggctggtcctattgggccgccggcgattggtggccg
gcgaacgagccgttcaacgtccagccgcgcaagggtcctgagcggccgcagatgcggctt
cttgccgaggtggcaaaagccggtgccggcacttgctccgccgtcaagcctgcggggaaa
tga

DBGET integrated database retrieval system