KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0243Help
Entry
RL0243            CDS       T00402                                 

Definition
(GenBank) putative dTDP-4-dehydrorhamnose 3,5-epimerase protein
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00521  Streptomycin biosynthesis
rle00523  Polyketide sugar unit biosynthesis
rle01130  Biosynthesis of antibiotics
Module
rle_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    RL0243
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RL0243
Enzymes [BR:rle01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     RL0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: CAK05733
GeneDB: RL0243
RhizoBase: RL0243
UniProt: Q1MMR9
Position
complement(282936..283439)
Genome map
AA seq 167 aa AA seqDB search
MEVDARSDDRGMFARTFDAQTFAAQGLVPVYPQCNVSQNHKRGTLRGMHYQAEPRPEIKL
VRATRGRVFDVALDLRPDSPSYLKWASVELDAIRHNAFYIPAGCAHGFLTLEDDCELYYQ
MSETYVPELARGVRWDDPAFSIAWPFTPSIINERDAALDSYGQETSL
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtggaagtcgacgcacgctccgacgaccggggaatgttcgcacgaaccttcgacgcgcag
acctttgcggcgcaaggtctcgtgcccgtctacccgcagtgcaatgtctcgcagaaccac
aagcgcgggacgctgcgcggcatgcattaccaagccgagccgcggccggagatcaagctg
gtgcgcgccacgcgcggcagggtattcgacgtggcgctcgatctgagaccggattcgccg
agctatctcaaatgggcctccgtcgagctcgatgccatcaggcacaacgccttctacata
cctgccggatgcgcacacggcttcctgacgctcgaggatgattgcgaactctattaccag
atgtcggaaacctacgtgccggaacttgcccgtggggtccgctgggacgatcccgccttt
tccatcgcctggccgttcacgccgagcatcatcaacgagcgcgacgccgcgcttgacagc
tacggccaggagacaagcctttga

DBGET integrated database retrieval system