KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0304Help
Entry
RL0304            CDS       T00402                                 

Definition
CoA reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     RL0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
335939..336973
Genome map
AA seq 344 aa AA seqDB search
MSGELVLVTGGSGFIAQHCILALLRAGYRVRTTLRSLSREAEVLSNLRTGGAEPGDRLSF
IAADLTADDGWAEAAAGCTYVIHGASPTPSGDQVCEEDWVRPAVDGNMRVLRAARDAGVK
RVVLTSAFGAIGVGHKPRSRPFVETDWSDLNGHVAPYQRSKTLAERASWDFIAREGGGLE
LASVNPTTVLGPALGPDYSHSIRLIKNLLDGQQGCPKINTCVVDVRDVADLHLRAMTDPA
ARGERFLAASGESLWMVEIARLLKQRLGKGASKVSTRVLPNWFVRVVALFNPAMKGIVPH
LGVNMNASSEKAQRLLGWEPRSREEAIGATADSLIRLGRVNMKD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgaactggtgctcgtgaccggcggaagcgggttcatcgcgcagcattgcatc
ctggcgctcttgcgggcgggctatcgcgtgcggaccacgctcaggtcactgtcgcgagag
gcggaggttctcagcaacctcaggactggcggtgccgagccaggcgaccgcctttcgttt
atcgctgctgaccttaccgccgacgacggctgggcggaggctgccgcaggctgcacctat
gtgatccacggcgcctcgcctacgccgtccggcgatcaggtgtgcgaggaagattgggtc
aggcctgcggtcgacggcaacatgcgcgtgctccgcgcggcacgcgatgcgggcgtgaag
cgggtggtgctcacctcggccttcggtgcgatcggcgtcggccacaaaccgcgaagtcgt
cccttcgtcgagaccgactggagtgacctgaacgggcatgtggcgccctatcagagatcg
aagacgctggccgagcgcgcgtcgtgggatttcattgcccgcgagggcggcgggctcgag
cttgcgagtgtcaaccccacgaccgtgctcgggcccgcgctcggtcccgactattcccac
tcgatccgtctcatcaagaacttgctggacggtcagcagggctgtcccaagatcaatacc
tgcgttgtcgacgtgcgcgacgtcgccgacttgcatctacgcgcgatgaccgatcccgca
gcaaggggcgagcgcttcctcgcagcgtcgggcgaaagcctgtggatggtcgagatcgcc
aggcttctcaaacaacgtctggggaaaggcgcgagcaaggtgtccacgcgtgttttgccc
aactggttcgtccgcgtcgtcgcgctgttcaatccggcgatgaaggggatcgtgccgcat
ctcggcgtcaatatgaacgccagcagcgagaaggcccaacgcctgcttggttgggagccc
cgctcgcgtgaagaggctatcggcgccacggccgacagcctcatccgcctcggccgggtc
aacatgaaggattag

DBGET integrated database retrieval system