KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0611Help
Entry
RL0611            CDS       T00402                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rle00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rle00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
662438..663730
Genome map
AA seq 430 aa AA seqDB search
MDRIRIVGGNELNGIIPISGAKNAALPLMIASLLTSDTLTLENVPHLADVELLMRILGNH
GVDVAVNGRRERQEDSYSRTIHFTCRTIVDTTASYELVSKMRASFWVIGPLLAREGHCRV
SLPGGCAIGTRPVDLFIEGLTALGATMEIDAGYINAKAPAGGLIGARYTFPKVSVGATHV
MMMAATLARGTTVIGNAAREPEVVDLANCLNAMGAKITGAGTATITIEGVTSLSGARHRV
LPDRIETGTYAMAVAMAGGDVVLENTDVALLETAVETLRRAGAEISSTNNGMRIKRNGAG
IRPVDIVTDPFPGFPTDLQAQFMALMTRSSGVSHVTETIFENRFMHVQELARLGARISLS
GQTAKIEGVQRLRGAPVMATDLRASVSLVIAGLAAEGETTVSRVYHLDRGFERLEEKLTR
CGAIVERISE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtatcagaatcgtcggcggtaatgagctgaatggcatcattccgatttccggc
gccaagaatgccgcactgccgctgatgatcgcctcgcttctgaccagcgatacgctgacg
ctcgaaaacgtgccgcatctggccgatgtcgagctgctgatgcgcatcctcggcaatcac
ggcgtcgacgtcgccgtcaacggccgccgcgagcgccaggaagattcctattcgcgcacg
atccacttcacctgccgcaccatcgtcgatacgaccgcatcctatgagctggtctctaag
atgcgcgcctccttctgggtcatcggcccgctgctggcgcgcgaaggccattgccgcgtt
tcgctgccgggcggctgtgccatcggcacgcgcccggtcgatctcttcatcgagggcctg
acggcgctcggcgcgaccatggagatcgatgccggttatatcaacgccaaggcgcctgcc
ggcggcctgatcggcgcacgctacaccttcccgaaggtctccgtcggcgccacccatgtg
atgatgatggcggcaacacttgcccgcggcacgactgtcatcggcaatgccgcccgcgag
cctgaggtcgtcgacctcgccaactgcctgaacgccatgggcgccaagataacgggcgcg
ggtactgcgacgatcaccatcgaaggcgtcacctcgctctctggcgcccgccatcgcgtc
ctgccggatcgcatcgaaaccggcacctacgccatggccgtcgccatggccggcggcgac
gtcgtgctcgaaaataccgacgtggcgctgctcgaaaccgcggtggaaacgctgcgccgc
gccggcgcggaaatctcgtcgaccaacaacggcatgcgcatcaagcgcaacggcgccggc
atcaggccggtcgatattgtcaccgatcctttcccgggcttcccgaccgacctgcaggcg
cagttcatggcgctgatgacccgttcttccggcgtctcgcatgtcaccgagaccatcttc
gaaaaccgtttcatgcatgtgcaggagcttgcccgcctcggcgccaggatctcgctgtcc
ggccagacggcgaagatcgagggtgtccaacgcctgcgcggcgcccctgtcatggcgacc
gatctgcgcgcctccgtctcgctcgtcatcgccggccttgccgccgagggtgaaaccacg
gtctcccgcgtctatcacctcgaccgcggtttcgagcggctcgaggagaagctgacccgc
tgcggcgccatcgtcgagcgcatcagcgagtaa

DBGET integrated database retrieval system