KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0613Help
Entry
RL0613            CDS       T00402                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RL0613 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    RL0613 (hisD)
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RL0613 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
664326..665624
Genome map
AA seq 432 aa AA seqDB search
MAIWLDQASEGFEQHFAAFLTTKREVSEDVNIVVRAIIDDVRARGDVALAEYSLKFDGID
YATVPMRVTAEEIDAAVEAVPSEVLGALKLAALRIESHHRRQLPKDDIYEDDMGVGLGSR
WTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVDRIVIAVPATGGAVNPAVLAAAKLVG
VTEIYRVGGAQAIAALAYGTETIAPVAKITGPGNAYVAAAKRHVFGTVGIDMIAGPSEVL
VIADKDNNPDWIAADLLAQAEHDVSSQAILITDDAAFGKAVEQAVERQLKTLNRAETAAA
SWRDFGAVILVADLKQAIPLANRIAAEHLELAVADPDRLLDGIRNAGAIFIGAHTPEVIG
DYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILRLGPQQLRTLGPAAIALAVSEGLDAH
ARSVAIRLNLER
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatctggctggatcaggcatcggaaggtttcgagcagcattttgccgccttcctg
acgacgaagcgtgaagtctccgaggatgtgaacatcgtcgttcgcgccatcatcgatgac
gtgcgcgcccgcggcgatgtggcgcttgccgaatattcgctgaaattcgacggcattgat
tacgccaccgtcccgatgcgtgtcacagctgaagagatcgacgccgccgtcgaggcggtg
ccttcggaagtgctgggggcgctgaagctcgcggcactgcgcatcgaatcccatcatcgc
cggcaactgccgaaggacgatatctacgaggacgatatgggtgtcggtctcggctcgcgc
tggacggcgatcgaagcggtcgggctctatgttccgggcggcacggcgagctatccgagc
tcggtgctgatgaatgccgtaccggccaaagtcgccggcgtcgatcgcatcgtcatcgcc
gttcccgccaccggcggcgctgtcaatccggcggtgcttgctgccgccaagcttgtcggc
gtcaccgagatttaccgtgtcggcggcgcccaggcgatcgcggctcttgcctatggcacc
gagacgatcgccccggtcgccaagatcaccggccccggcaatgcctatgtcgccgccgcc
aagcgccatgtcttcggcactgtcggcatcgacatgatcgccggcccctccgaagtgctt
gtcattgcagacaaggacaacaatccggattggatcgcagccgacctcttggcccaggcc
gagcacgatgtcagttcccaggcgatcctgatcaccgacgatgccgcattcggcaaggcg
gtggagcaggcagtcgaacgccagctgaagacgctgaatcgggccgagacggcggcggca
agctggcgcgatttcggcgcggtcatcctcgttgccgatctgaaacaggccattcccttg
gcaaaccgcatcgctgccgagcatctggagctcgccgtcgccgatccggaccggctgctc
gacggcatccgcaatgccggcgcgatcttcatcggcgcccatacgcctgaggtgatcggc
gattatgtcggcggttcgaaccatgtgctgccgacggcgcgttcggcgcgcttctcatcc
ggcctttcggtgcttgatttcgtcaagcgcacctcgatcctgcgccttgggccccagcag
ctccggaccctcggcccggcggcgatcgcccttgctgtctccgaaggcctcgatgcccat
gcgcgatcggtcgcgatccgcctcaacctcgaaaggtga

DBGET integrated database retrieval system