KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0761Help
Entry
RL0761            CDS       T00402                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RL0761
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RL0761
Enzymes [BR:rle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RL0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(815983..817272)
Genome map
AA seq 429 aa AA seqDB search
MTDFYKLVPNASASRFDGIERPYSAEDVQRLRGSVALSHTLAEMGADRLWRLLHQEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRINRT
LQRADQIETAEAQGLSVETWFAPIVADAEAGFGGPLNAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLDAARLAADVMGVATLVIARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTVEGFYQVRNGIEPCIARAVAYAPHCDLIWCETSKPDLDQARRFAEGVHKV
HPGKLLAYNCSPSFNWKKNLDEATIARFQRELGAMGYKFQFITLAGFHQLNYGMYELARG
YRQRQMSAYSELQQAEFAAEVNGYTATKHQREVGTGYFDAVSLAITGGRSSTTAMHGSTE
HAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttttacaagcttgttccaaatgcatcagccagccgcttcgacggcatcgag
agaccgtactcggccgaagacgtgcagcggctcagaggctcggtggcgctcagccatacg
ctggccgaaatgggggcggaccggttgtggcggcttctgcatcaggaggatttcgtcaat
gcgctcggcgcactttccggcaatcaggccatgcagatggtgcgcgccgggttgaaggcg
atctatctctccggctggcaggtggcggccgacgccaacaccgcatcggcgatgtatccc
gaccagtccctctatccggccaatgccggtccggaacttgccaaacgcatcaatcgcacg
ctgcagcgcgccgatcagatcgagaccgcggaagctcaggggctttccgtcgaaacctgg
ttcgcgccgatcgttgccgatgcggaagcaggcttcggcggaccgctcaacgccttcgaa
atcatgaaggcctatatcgaggcgggtgccgcgggcgttcacttcgaggaccaactcgcc
tcggagaaaaagtgcggtcatctcggcggcaaagtgctgatcccgacggccgcccatatc
cgcaatctcgacgccgcacggcttgccgccgacgtcatgggcgttgcgacgctggtcatc
gctcgcaccgacgcggaagcggcaaagctcttgacgtcagacatcgacgagcgcgaccag
cccttcgtcgactatgatgccgggcgcacggtcgaaggtttctatcaggtgcgaaacggc
atcgagccgtgcatcgcgcgcgccgtcgcctatgcgccgcattgcgatctcatctggtgc
gagacctcgaagccggacctcgatcaggcgcggcgttttgccgaaggcgtgcacaaggtc
catcccggcaagctgctcgcctataattgttcgccttccttcaactggaagaagaacctc
gacgaagcgacgatcgcaaggttccagcgcgaactcggggcgatgggctacaagttccag
ttcatcacgctcgccggcttccaccagctgaactacggcatgtacgaactggcgcgcggc
taccggcagcggcagatgtcggcctattccgagctgcagcaggcggaattcgccgccgag
gtcaatggctataccgccaccaaacatcagcgcgaggtcggcaccggctatttcgacgcc
gtgtcgctcgccatcaccggcggccggtcttcgaccacggcgatgcacggctcgaccgaa
catgcgcagttcaaaccggctgcggaataa

DBGET integrated database retrieval system