KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0761Help
Entry
RL0761            CDS       T00402                                 

Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RL0761
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RL0761
Enzymes [BR:rle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RL0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(815983..817272)
Genome map
AA seq 429 aa AA seqDB search
MTDFYKLVPNASASRFDGIERPYSAEDVQRLRGSVALSHTLAEMGADRLWRLLHQEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRINRT
LQRADQIETAEAQGLSVETWFAPIVADAEAGFGGPLNAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLDAARLAADVMGVATLVIARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTVEGFYQVRNGIEPCIARAVAYAPHCDLIWCETSKPDLDQARRFAEGVHKV
HPGKLLAYNCSPSFNWKKNLDEATIARFQRELGAMGYKFQFITLAGFHQLNYGMYELARG
YRQRQMSAYSELQQAEFAAEVNGYTATKHQREVGTGYFDAVSLAITGGRSSTTAMHGSTE
HAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttttacaagcttgttccaaatgcatcagccagccgcttcgacggcatcgag
agaccgtactcggccgaagacgtgcagcggctcagaggctcggtggcgctcagccatacg
ctggccgaaatgggggcggaccggttgtggcggcttctgcatcaggaggatttcgtcaat
gcgctcggcgcactttccggcaatcaggccatgcagatggtgcgcgccgggttgaaggcg
atctatctctccggctggcaggtggcggccgacgccaacaccgcatcggcgatgtatccc
gaccagtccctctatccggccaatgccggtccggaacttgccaaacgcatcaatcgcacg
ctgcagcgcgccgatcagatcgagaccgcggaagctcaggggctttccgtcgaaacctgg
ttcgcgccgatcgttgccgatgcggaagcaggcttcggcggaccgctcaacgccttcgaa
atcatgaaggcctatatcgaggcgggtgccgcgggcgttcacttcgaggaccaactcgcc
tcggagaaaaagtgcggtcatctcggcggcaaagtgctgatcccgacggccgcccatatc
cgcaatctcgacgccgcacggcttgccgccgacgtcatgggcgttgcgacgctggtcatc
gctcgcaccgacgcggaagcggcaaagctcttgacgtcagacatcgacgagcgcgaccag
cccttcgtcgactatgatgccgggcgcacggtcgaaggtttctatcaggtgcgaaacggc
atcgagccgtgcatcgcgcgcgccgtcgcctatgcgccgcattgcgatctcatctggtgc
gagacctcgaagccggacctcgatcaggcgcggcgttttgccgaaggcgtgcacaaggtc
catcccggcaagctgctcgcctataattgttcgccttccttcaactggaagaagaacctc
gacgaagcgacgatcgcaaggttccagcgcgaactcggggcgatgggctacaagttccag
ttcatcacgctcgccggcttccaccagctgaactacggcatgtacgaactggcgcgcggc
taccggcagcggcagatgtcggcctattccgagctgcagcaggcggaattcgccgccgag
gtcaatggctataccgccaccaaacatcagcgcgaggtcggcaccggctatttcgacgcc
gtgtcgctcgccatcaccggcggccggtcttcgaccacggcgatgcacggctcgaccgaa
catgcgcagttcaaaccggctgcggaataa

DBGET integrated database retrieval system