KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0935Help
Entry
RL0935            CDS       T00402                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RL0935
Enzymes [BR:rle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RL0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(1004213..1005124)
Genome map
AA seq 303 aa AA seqDB search
MMSSENRSHFSASCSSITEEARAKINLALHVTGQRPDGYHLLDMLVTFADHGDRLDFVPS
PTDAFTLSGRFGGTLAGGSGTNLVLKARDLLRAAIGPLAFPVRIHLEKNLPIASGIGGGS
ADAAATLRGLTRLWGATLPEEALAALALKLGADVPMCLESRPLIARGIGEELEPVPELPA
FAMVLANPLKGVSTPEVFRRLAEKNNPALSLALSRPQTADWLAAIAAARNDLEPPARELV
PEIAAISAMLQAHGALLTRMSGSGATCFGIFATMAAAKDAAAALHEARLDWYFQATETVS
GGV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgtccgaaaaccgctcacacttttcggcatcatgctccagcatcaccgaggaa
gctcgcgcgaagatcaacctggccctgcatgtgacgggccagcggccggatggctatcat
ctgctcgatatgctggtgaccttcgcagatcacggcgaccggctggacttcgtgccgtcg
ccgaccgatgcgttcactctgtcgggccgttttggcggaacacttgccggcggcagcggc
accaacttggtgctgaaggcccgcgatctcctacgcgcggcgatcggtcccctcgccttc
cccgtccgcatccatttggaaaagaacctgccgatcgcctccggcatcggcggcggctcg
gcggatgcggctgcgacgctgcgcgggctgacgcggctctggggcgcgacgttgcccgag
gaggcgctcgcagctctcgccctgaagctcggcgccgacgtgccgatgtgccttgagagc
cggccgttgattgcccgcggcatcggcgaagagctcgaacccgtgccggagctgccggcc
tttgccatggtgctcgccaatccgctgaagggcgtctcgacgcctgaggttttccgccgg
ctggcggagaaaaacaatccggctctgagcttggcactgagccggcctcagactgccgac
tggctcgcggcgattgctgctgcccgcaacgacctagagccgccggcgcgcgaactcgtg
cccgagatcgcggcgatctcggcgatgttgcaggcccatggcgcgcttttgacccgcatg
tccggttccggcgccacctgtttcggcatctttgcgacgatggcggctgcgaaagacgcg
gcggcagctcttcacgaggcgcgcctcgactggtatttccaggcgacggaaacggtttcg
ggaggcgtatga

DBGET integrated database retrieval system