KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0954Help
Entry
RL0954            CDS       T00402                                 

Gene name
gpmB
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:rle01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rle01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rle00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:rle00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rle00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
1028003..1028584
Genome map
AA seq 193 aa AA seqDB search
MSSAFPEIYLVRHGETEWSLSGRHTGRSDIPLTSNGEEAARKIADRLAGLSFSAVWSSPS
ERARKTCALAGFGSGAVIKDDLAEWDYGAYEGITTKAILADRPGWQLFRDGCPKGEFAAD
VGDRADAVIGGLRQTAGTILIFSSSHFLRVLAARWLGLPPEDGARFVLDTASISVLGYEH
DLTEPVIRRWNQR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgcgtttcccgagatctacttggtccgccacggtgaaaccgaatggagcctg
tccgggcgccataccggacgcagtgatattcccttgacgtcgaatggcgaagaggccgcc
cgcaaaatcgccgaccggctggcgggccttagcttctccgccgtctggtcgagcccctcc
gagcgagcccgcaagacctgcgcgctcgccggattcggatcgggcgcggtgatcaaggac
gatctcgccgaatgggactatggcgcttacgaaggcatcaccaccaaggcgatccttgcc
gaccgccccggctggcagctctttcgcgacggctgcccgaagggcgaattcgccgccgat
gtcggcgatcgcgccgacgccgtgattggcggacttcgtcagacggccggcaccatcctg
atcttttcgagttcgcatttcctgcgggtcctcgccgcccgctggcttggcctgccgccg
gaagacggcgcgcgtttcgtgctcgataccgcgagcatcagcgtgctcggctatgagcac
gatctgaccgaaccggtcatccgccgctggaaccagagatag

DBGET integrated database retrieval system