KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1062Help
Entry
RL1062            CDS       T00402                                 

Gene name
thrC
Definition
(GenBank) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00260  Glycine, serine and threonine metabolism
rle00750  Vitamin B6 metabolism
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01230  Biosynthesis of amino acids
Module
rle_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RL1062 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RL1062 (thrC)
Enzymes [BR:rle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RL1062 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: CAK06559
GeneDB: RL1062
RhizoBase: RL1062
UniProt: Q1MKE6
Position
complement(1141895..1143319)
Genome map
AA seq 474 aa AA seqDB search
MMNVDYISTRGEAPSLGFCDALLTGLARDGGLYVPRKWPSFSKKEIRALRGKTYQEIAFT
ILSPFTNGEIPDDTFRAMIDEAYGTFRHPAIAPLVQTGPNSFVMELFHGTTLAFKDVAMQ
LLARLMDYALEKRGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQM
TTSSSANVHALAVEGNFDDCQNLVKAMFNDVTFRDKVRLSGVNSINWARIMAQIVYYFTA
AVALGGPDRKISFTVPTGNFGDIFAGYCAKRMGLPIDRLVIATNENDILARTLKTGRYDM
KAVKATSSPSMDIQISSNFERLLFEAYDRDASKVRAAMESLKQSNGFEIGSQALKAIRRD
FRAGRASEKQVAETIRKTHAETGYLLDPHSAIGVFVAAKKEKPNTPMVTLSTAHPAKFPA
AVKSACGIDPALPTWLADLMHREERFQIIKPELKAVETFIGKHARGETTAGAER
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgtggattatatctcgactcgcggcgaggccccttccctcggcttttgcgac
gcccttttgaccgggctggcgcgcgatggcgggctctatgttccgcgcaaatggccgagc
ttttccaaaaaggagatccgtgcgctcaggggcaagacctatcaggagatcgccttcacc
atcctgtcgcccttcaccaatggcgagatccccgacgacacgttccgggcgatgatcgac
gaggcctacggcactttccgccatccggcgatcgcgccgctcgtccagaccgggccgaac
agcttcgtcatggagctcttccacggcaccacgctcgccttcaaggacgtggcgatgcaa
ttgctcgcccggctgatggactatgcgctggaaaagcgcggcgagcgggcgacgatcgtc
ggcgccacctcgggcgacaccggcggggcagcgatcgacgccttcgcgggccgcgagcgc
accgatatcttcatcctcttcccgcatggcaaggtctcgccggtgcagcagcggcagatg
acgacctcgtcgtcagcaaacgtgcatgcgcttgccgtcgagggtaatttcgacgattgc
cagaacctcgtgaaagcgatgttcaacgacgtgaccttccgcgacaaggtccggctatcc
ggcgtcaactcgatcaactgggcccgcatcatggctcagatcgtctattatttcacggcg
gcggtggcgcttggcggtccggaccggaagatctcgttcacggtgcccacaggcaatttc
ggcgatatcttcgccggctactgcgccaagcgcatgggcctgccgatcgaccgtctggtg
atcgccaccaacgagaacgacatcctggcgcggacgctgaagaccggccgctacgacatg
aaggcggtcaaggcgacgagttcgccgtcgatggacatccagatctcctcgaacttcgaa
cggctgctgttcgaagcctatgaccgcgacgcctcgaaagtgcgcgcggcgatggaaagc
ctcaagcaatccaacggcttcgagatcggcagccaagcgctgaaggcgatccgccgcgac
ttccgcgccgggcgcgccagcgagaagcaggtcgccgagacgatccgcaagacccatgcc
gaaaccggttatctgctggatccgcattcggcgatcggcgtcttcgtcgctgccaagaaa
gaaaagccgaatacgccgatggtgacgctttcgaccgcgcatccggcgaaattccccgcc
gccgtaaaatccgcctgcggtattgacccggcgcttccgacgtggcttgctgatctgatg
cacagggaggagcgtttccagatcatcaaaccggagctgaaagccgttgagacttttatc
ggcaagcatgcccgcggcgagacgacagcaggcgcagaaagatag

DBGET integrated database retrieval system