KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1062Help
Entry
RL1062            CDS       T00402                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RL1062 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RL1062 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RL1062 (thrC)
Enzymes [BR:rle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RL1062 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(1141895..1143319)
Genome map
AA seq 474 aa AA seqDB search
MMNVDYISTRGEAPSLGFCDALLTGLARDGGLYVPRKWPSFSKKEIRALRGKTYQEIAFT
ILSPFTNGEIPDDTFRAMIDEAYGTFRHPAIAPLVQTGPNSFVMELFHGTTLAFKDVAMQ
LLARLMDYALEKRGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQM
TTSSSANVHALAVEGNFDDCQNLVKAMFNDVTFRDKVRLSGVNSINWARIMAQIVYYFTA
AVALGGPDRKISFTVPTGNFGDIFAGYCAKRMGLPIDRLVIATNENDILARTLKTGRYDM
KAVKATSSPSMDIQISSNFERLLFEAYDRDASKVRAAMESLKQSNGFEIGSQALKAIRRD
FRAGRASEKQVAETIRKTHAETGYLLDPHSAIGVFVAAKKEKPNTPMVTLSTAHPAKFPA
AVKSACGIDPALPTWLADLMHREERFQIIKPELKAVETFIGKHARGETTAGAER
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgtggattatatctcgactcgcggcgaggccccttccctcggcttttgcgac
gcccttttgaccgggctggcgcgcgatggcgggctctatgttccgcgcaaatggccgagc
ttttccaaaaaggagatccgtgcgctcaggggcaagacctatcaggagatcgccttcacc
atcctgtcgcccttcaccaatggcgagatccccgacgacacgttccgggcgatgatcgac
gaggcctacggcactttccgccatccggcgatcgcgccgctcgtccagaccgggccgaac
agcttcgtcatggagctcttccacggcaccacgctcgccttcaaggacgtggcgatgcaa
ttgctcgcccggctgatggactatgcgctggaaaagcgcggcgagcgggcgacgatcgtc
ggcgccacctcgggcgacaccggcggggcagcgatcgacgccttcgcgggccgcgagcgc
accgatatcttcatcctcttcccgcatggcaaggtctcgccggtgcagcagcggcagatg
acgacctcgtcgtcagcaaacgtgcatgcgcttgccgtcgagggtaatttcgacgattgc
cagaacctcgtgaaagcgatgttcaacgacgtgaccttccgcgacaaggtccggctatcc
ggcgtcaactcgatcaactgggcccgcatcatggctcagatcgtctattatttcacggcg
gcggtggcgcttggcggtccggaccggaagatctcgttcacggtgcccacaggcaatttc
ggcgatatcttcgccggctactgcgccaagcgcatgggcctgccgatcgaccgtctggtg
atcgccaccaacgagaacgacatcctggcgcggacgctgaagaccggccgctacgacatg
aaggcggtcaaggcgacgagttcgccgtcgatggacatccagatctcctcgaacttcgaa
cggctgctgttcgaagcctatgaccgcgacgcctcgaaagtgcgcgcggcgatggaaagc
ctcaagcaatccaacggcttcgagatcggcagccaagcgctgaaggcgatccgccgcgac
ttccgcgccgggcgcgccagcgagaagcaggtcgccgagacgatccgcaagacccatgcc
gaaaccggttatctgctggatccgcattcggcgatcggcgtcttcgtcgctgccaagaaa
gaaaagccgaatacgccgatggtgacgctttcgaccgcgcatccggcgaaattccccgcc
gccgtaaaatccgcctgcggtattgacccggcgcttccgacgtggcttgctgatctgatg
cacagggaggagcgtttccagatcatcaaaccggagctgaaagccgttgagacttttatc
ggcaagcatgcccgcggcgagacgacagcaggcgcagaaagatag

DBGET integrated database retrieval system