KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1325Help
Entry
RL1325            CDS       T00402                                 

Definition
(RefSeq) alcohol dehydrogenase (EC:1.1.1.1)
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RL1325
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RL1325
  Lipid metabolism
   00071 Fatty acid degradation
    RL1325
  Amino acid metabolism
   00350 Tyrosine metabolism
    RL1325
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RL1325
   00626 Naphthalene degradation
    RL1325
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RL1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(1388665..1389708)
Genome map
AA seq 347 aa AA seqDB search
MKAMFYEAFEQAPEIRTVADPTPTEDGVVISVGASGLCRSDWHGWMGHDPDIRLPHVPGH
ELAGRIVATGRGVMRFKVGDRVTVPFVSGCGHCGECHSGNQQVCPNQFQPGFTHWGSFAE
YVAIDYADTNLVHLPDTIDDATAASLGCRFATSFRAVADQARTRPGEWISVHGCGGVGLS
AIMIATALGANAIGIDISEEKLAFARECGAVATVNASGVADVAEAVREITKGGAHVSIDA
LGHPVTCFNSIKNLRRRGRHVQVGLMLGEHATPQIPMAQVIGQELEIYGSHGMQAWRYDA
MLSMLSAGKIAPQKLIGRRISLEEAVPALMALDKAESTGISVITRFS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatgttctacgaagccttcgaacaggcgcccgaaatccgcaccgttgccgat
ccgactccgacagaggacggtgtcgtcatatccgtcggggccagcgggctctgccgcagt
gactggcacggctggatgggccacgacccggatatccgcctgccgcatgtgccgggacat
gagcttgccgggcggatcgtcgccaccggccgcggcgtgatgcgcttcaaggtgggcgac
cgggtgaccgtgcccttcgtttccggctgcggccattgcggggagtgccattccggcaac
cagcaggtctgcccgaaccagttccagccgggcttcacccattgggggtcgtttgccgaa
tatgtggcgatcgattatgccgataccaatctggtgcacctgcccgatacgatcgacgat
gcgacggcggcaagcctcggctgccgcttcgccacctcgtttcgcgccgtcgccgaccag
gcgcgcaccaggcccggcgaatggatctcagtgcatggctgcggcggtgtcggcctgtcg
gcgatcatgatcgccacggcgcttggggcgaatgcgatcggcatcgacatttccgaggag
aagctcgcctttgcccgggagtgcggggcggtggcgacggtcaacgcgtcaggcgtcgcc
gatgtggcggaggcggtgcgcgagatcaccaagggcggcgcgcatgtctcgatcgacgcg
ctcggccatcccgtcacctgcttcaactcgatcaagaatctgcgccggcgcggacggcat
gtgcaggtggggttgatgctcggcgagcatgcgacgccgcaaatcccgatggcacaggtg
atcggccaagagctggaaatctacggcagccacggcatgcaggcatggcgatacgacgcc
atgctgtcgatgctttcggccggaaagatcgcaccgcagaagctgatcggacgccgcatc
agcctcgaggaggccgtgccggcgctgatggcgctcgacaaggctgagtctacggggatc
agcgtgattacccggttttcatga

DBGET integrated database retrieval system