KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1563Help
Entry
RL1563            CDS       T00402                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RL1563 (gmk)
Enzymes [BR:rle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RL1563 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
1630856..1631518
Genome map
AA seq 220 aa AA seqDB search
MKPAKSSPVQIARRGLMLVISSPSGAGKSTIARTLLETDRQIGLSVSVTTRQRRPSEVED
VHYHFKSVREFERLRDSDALLEWAEVHGNFYGTPREPVEQAMGEGRDMLFDIDWQGAQQL
QEKMSADVVSIFVLPPTMTELQSRLHRRAEDSEEVIQTRLANSRAEIAHWREYDYVIVND
DLNAALDAVQSIVKAERLRRDRRHGMFDFVRELLEETPSL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggcgaaatcctcgcccgtgcagatcgcccgccgcggtctaatgcttgtcatc
tcgtcgccatcaggcgccggcaagtccaccatcgcgcgcacgctgctggagaccgacagg
caaatcggcctttccgtcagcgtcaccacgcgccagcgccgtccgagcgaagtcgaggat
gtgcattaccacttcaagagtgtgcgcgagttcgagcggctgcgcgatagcgacgccctg
ctcgaatgggccgaggtgcatggcaatttctacggcacgccgcgtgagccggtcgagcag
gccatgggtgaaggccgcgacatgctcttcgacatcgattggcagggcgcccagcaattg
caggagaagatgtcggccgacgtcgtctccatcttcgtgctgccgccgaccatgaccgag
ctccagtcgcggctgcatcgccgtgcggaggattccgaggaggtcatccagacgcgcctc
gccaacagccgcgccgagatcgctcactggcgcgaatacgactatgtcatcgtcaatgac
gatctcaacgccgccctcgacgccgtccagtcgatcgtcaaggccgaacgcctgcgccgc
gaccgccgccacggcatgttcgacttcgtccgcgagttgctggaagagacgccgtcgctt
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system