KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1572Help
Entry
RL1572            CDS       T00402                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RL1572
   00240 Pyrimidine metabolism
    RL1572
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RL1572
   03430 Mismatch repair
    RL1572
   03440 Homologous recombination
    RL1572
Enzymes [BR:rle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RL1572
DNA replication proteins [BR:rle03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RL1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
1641655..1642104
Genome map
AA seq 149 aa AA seqDB search
MTDVLFYHLTESRLEDALPPLIDKSVERGWRVAVQTREPARRDALDQHLWTFREESFLPH
GTDEADFAESQPVLLTVTPDNANAATVRFIVDGAEPPPADAYERIVFMFDGHDQEQLDTA
RAQWKKLKGEGHNLTYWQQTPEGRWEKKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgttctcttctatcatctgaccgaatccaggctggaggacgcgcttccgccg
ctcatcgacaaaagcgtcgagcgcggctggcgcgttgccgtccagacgcgcgagccggcg
cggcgtgatgctctcgatcagcatctttggactttccgggaggagagcttcctgccgcac
ggcaccgacgaggcggatttcgccgaaagccagccggtgcttttgaccgtgacgccggac
aacgccaatgcggcgaccgtgcgtttcatcgtcgacggcgccgagccgccgccggccgat
gcctatgagcgcatcgtcttcatgttcgacggtcacgaccaggagcaactggacaccgcc
cgtgcgcagtggaagaagctgaaaggggagggacataacctcacctattggcagcagaca
ccggaagggcgatgggagaagaaggcctga

DBGET integrated database retrieval system