KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1616Help
Entry
RL1616            CDS       T00402                                 

Gene name
hemB
Definition
(GenBank) putative delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00860  Porphyrin and chlorophyll metabolism
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RL1616 (hemB)
Enzymes [BR:rle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RL1616 (hemB)
Exosome [BR:rle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RL1616 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: CAK07111
GeneDB: RL1616
RhizoBase: RL1616
UniProt: Q1MIU9
Position
complement(1689408..1690421)
Genome map
AA seq 337 aa AA seqDB search
MQDRTHLVDDITGHRRMRRNRKADWTRRLVQENRLTVDDLIWPIFIVPGSGIVDPIPAMP
GVNRMSIDKAVEAAREAAGLGIPALATFPNIEMELRDETGSNSLEANNLINQATAAIKKA
VPDIGIITDVALDPFTSHGHDGILRGSEIVNDETVDQVARAAVMQADAGADIIAPSEMMD
GRIGAIRMALDAAGHQSVGIMSYATKFASAFYGPYREAISTGGLLKGDKKTYYIDPANGT
EAIRDAALDVEEGADMLMVKPGLPYLDICWRMKEAFGLPTFAYQVSGEYTQIKAAAMNGW
IDGERAMLETLLSFKRAGCDGVLTYFAIEVAKILAKR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacaggacgcatctcgtcgacgacatcaccggccatcgccgcatgcggcgcaac
cgcaaggcggattggacgcgccggctggtgcaggaaaaccggctgacggtcgatgacctg
atctggccgatcttcatcgtgccgggttccggcatcgtcgatccgatcccggccatgccc
ggcgtcaaccgcatgagcatcgacaaggccgtggaagccgcgcgcgaagccgccggcctc
ggcattccggcgcttgccacctttccgaatatcgagatggagctgcgcgacgagaccggc
tctaacagcctcgaagccaacaacctgatcaatcaggcgacggcggcgatcaagaaggcg
gtgcctgatatcggcatcattaccgatgtcgcgctcgatcccttcaccagccacggccat
gacggcattctcagaggcagcgagatcgtcaatgacgagacggtcgaccaggtggcgcgc
gccgccgtgatgcaggcggatgcgggcgccgacatcatcgcgccgtcggagatgatggac
ggacgcatcggcgcgatccgcatggcgctcgatgcggccggccaccagagcgtcggcatc
atgagctatgcgacgaaattcgcctccgccttctacggtccctatcgcgaggcgatctcg
acgggcgggctgctgaaaggcgacaagaagacctattatatcgaccccgccaatggcacc
gaggcgatccgcgacgctgccctcgacgtcgaggaaggcgccgacatgctgatggtcaag
cccggcctgccctatctcgatatctgctggcggatgaaggaggcctttggcctgccgacc
ttcgcctaccaggtttccggcgaatacacgcaaatcaaggcagcggcgatgaatggctgg
atcgacggcgagcgagcgatgctcgaaacgctactgtcgttcaagcgggcgggatgcgac
ggtgtcctcacctatttcgcgatcgaagtggcgaaaattctcgcaaagcggtga

DBGET integrated database retrieval system