KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1648Help
Entry
RL1648            CDS       T00402                                 

Gene name
celC
Definition
(GenBank) putative endoglucanase/cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
1723771..1724817
Genome map
AA seq 348 aa AA seqDB search
MRRWRALLLAASVALAPGGAPAVAQQAMINAGAWSAYKAKFLDATGRIIDNGNGNISHSE
GQGYGMLLAYLAASPADFEQIWYFTRTELLLRNDGLAVWKWDPNVKPHVTDTNNASDGDM
LIAYALALAGTAWKRNDYILAASRMAQALLAETVVHASGHTLLLPGSEGFAATDREDGPV
VNPSYWIYEAIPVMGALAPSDAWQKLSDDGLTLLKTMQFGPRKLPAEWVSLNGQPQPAEG
FDAEFAYNAIRIPLYLVRGGVTDKALLTHLREGMSQDGVPATIDLTTGRPKTVLPDPGYR
IVNDVVACVVDGTKLPGSALQFAPALYYPSTLQLLGLAYIGEKHPECL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggtggcgcgcactcctgttggcggcatcggtcgcgctcgctcccgggggagcg
cccgccgttgcgcagcaggcgatgatcaatgccggcgcatggtcggcctacaaggcgaag
tttctcgatgcgaccggccgtatcatcgataacggcaacggcaatatcagccacagcgaa
gggcagggctatggcatgctgctcgcctatctcgcagccagccctgccgacttcgagcag
atctggtattttacgcgcacggagctgctgctgcgcaacgatggcctggctgtctggaag
tgggatccgaacgtcaagccgcatgtcaccgacaccaacaatgcctcggatggcgacatg
ctgatcgcctatgcgctggcgctcgccggcacggcgtggaaacgcaacgactatatcctc
gccgcctcccgcatggcgcaggcgctgcttgccgaaaccgttgtgcacgcgtccggccac
acactcctgttgccggggagtgagggttttgccgctaccgaccgtgaggacggtcctgtc
gtcaacccgtcctactggatttacgaggcgattccggtgatgggggcgctcgcgccgtcg
gatgcctggcaaaaactgtcggacgatggcctaacgctgttgaaaacgatgcagttcggc
ccgcgcaaacttcccgccgaatgggtgagtctcaacggccagccgcagccggccgaaggt
ttcgatgcggaatttgcctataatgccatccgcattccgctctatctcgttcgtggcggc
gtcaccgacaaggcgctgctgacccatctgcgcgaggggatgtcgcaagacggcgttccc
gccaccatcgatctgaccaccggccggccgaagaccgtgttgccggatcccggttataga
attgttaacgatgttgtggcctgtgtagtcgatgggaccaagctgccgggctcggccctg
caatttgcgcccgcactctattatccgtccacgcttcagctgctggggctggcctatatt
ggggagaagcatccggagtgtctgtga

DBGET integrated database retrieval system