KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1686Help
Entry
RL1686            CDS       T00402                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RL1686
  Amino acid metabolism
   00380 Tryptophan metabolism
    RL1686
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RL1686
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     RL1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(1765142..1766434)
Genome map
AA seq 430 aa AA seqDB search
MPHIFPRPGKSAKPRGMMIPSFLSIDRANRHVSLDSRNPAFYGDPNAVYAALHAHCPTFY
WSEQKQWFFTGYDHVNGLLRDRRFGRQILHIASREELGLAEPMPHLASFDLSERYSLLEL
EPPEHTRLRTLVNRAFVSRHVEKMKPELAELANRLIDGFAEKREVELLSAFADIIPVTMI
ARMIGIPEEMGPQLLAWSHAYVRMYMFGRTREQEEEAERAAKEFSDYVKTVITERRATPR
DDLLTHMIHTEHKGQYLTEEELVSTTIVLLNAGHEATVHQIGNSVRTILDSGCDPAELFR
DEATTERTVEETLRICAPVHIFQRWALEPAEIDGVSFKRGDKVSLILAAANLDPAKFTDP
LTFKPDRNEAANLSFGAGIHFCIGAPLARLELNVVLPILFERLAGLKMAKTPVVKDVYHF
HGLDRLDLQW
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgccccacatcttcccgaggcccggcaaatccgctaagcctcggggcatgatgatccca
tcctttctctcgatcgaccgcgccaaccgtcatgtctcgcttgatagccgcaacccggcc
ttctacggcgacccgaatgccgtctatgccgcacttcatgcccattgcccgaccttctac
tggagcgagcagaagcagtggttctttacgggttacgaccatgtgaacggcctgctccgc
gaccgccgcttcggccggcagatcctgcatatcgccagccgcgaggagctcggccttgcc
gagccgatgccgcatcttgccagtttcgatctctcggaacgttattccctgctcgaactc
gaaccgcccgagcacacgcggctgcgcacgctcgtcaaccgcgccttcgtttcccgccat
gtcgagaagatgaagccggaacttgccgaactcgccaaccggctgatcgacggcttcgcg
gagaagcgtgaggtcgagctgctctcggcctttgccgacatcatcccggtgacgatgatc
gcccggatgatcggcattcccgaggagatggggccgcagctgctcgcctggtcgcacgcc
tatgtccgcatgtacatgttcggccgcacgcgcgagcaggaagaagaggccgaacgggcg
gccaaggaattttccgactacgtcaagacggtgatcacggaacgccgcgcgaccccacgc
gacgacctgctgacccacatgatccataccgagcacaagggccagtatctgaccgaggag
gaactcgtctcgacgacgatcgtgctgctcaatgccgggcatgaggcgaccgtgcaccag
atcggcaactccgtgcgcaccattctcgacagcggctgcgatccggcggaactcttccgg
gacgaggcgacgacggagcgcaccgtcgaggaaaccctgcgcatctgcgcgccggtccat
atcttccagcgctgggccctggagcctgccgaaatcgacggcgtctccttcaagcgcggc
gacaaggtcagccttatcctcgccgccgccaatctcgatccggcgaaattcaccgacccc
ctcaccttcaagcccgaccgcaacgaggcggcgaacctctccttcggcgccggcatccat
ttctgcatcggcgcgccgttggcacggctcgagctcaacgtcgtgctgccgatcctgttc
gaacggctggccggcctcaagatggcaaagacacccgtggtcaaggacgtctaccatttc
cacgggctggaccggctggatctgcaatggtga

DBGET integrated database retrieval system