KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1686Help
Entry
RL1686            CDS       T00402                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rle00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:rle00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rle00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(1765142..1766434)
Genome map
AA seq 430 aa AA seqDB search
MPHIFPRPGKSAKPRGMMIPSFLSIDRANRHVSLDSRNPAFYGDPNAVYAALHAHCPTFY
WSEQKQWFFTGYDHVNGLLRDRRFGRQILHIASREELGLAEPMPHLASFDLSERYSLLEL
EPPEHTRLRTLVNRAFVSRHVEKMKPELAELANRLIDGFAEKREVELLSAFADIIPVTMI
ARMIGIPEEMGPQLLAWSHAYVRMYMFGRTREQEEEAERAAKEFSDYVKTVITERRATPR
DDLLTHMIHTEHKGQYLTEEELVSTTIVLLNAGHEATVHQIGNSVRTILDSGCDPAELFR
DEATTERTVEETLRICAPVHIFQRWALEPAEIDGVSFKRGDKVSLILAAANLDPAKFTDP
LTFKPDRNEAANLSFGAGIHFCIGAPLARLELNVVLPILFERLAGLKMAKTPVVKDVYHF
HGLDRLDLQW
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgccccacatcttcccgaggcccggcaaatccgctaagcctcggggcatgatgatccca
tcctttctctcgatcgaccgcgccaaccgtcatgtctcgcttgatagccgcaacccggcc
ttctacggcgacccgaatgccgtctatgccgcacttcatgcccattgcccgaccttctac
tggagcgagcagaagcagtggttctttacgggttacgaccatgtgaacggcctgctccgc
gaccgccgcttcggccggcagatcctgcatatcgccagccgcgaggagctcggccttgcc
gagccgatgccgcatcttgccagtttcgatctctcggaacgttattccctgctcgaactc
gaaccgcccgagcacacgcggctgcgcacgctcgtcaaccgcgccttcgtttcccgccat
gtcgagaagatgaagccggaacttgccgaactcgccaaccggctgatcgacggcttcgcg
gagaagcgtgaggtcgagctgctctcggcctttgccgacatcatcccggtgacgatgatc
gcccggatgatcggcattcccgaggagatggggccgcagctgctcgcctggtcgcacgcc
tatgtccgcatgtacatgttcggccgcacgcgcgagcaggaagaagaggccgaacgggcg
gccaaggaattttccgactacgtcaagacggtgatcacggaacgccgcgcgaccccacgc
gacgacctgctgacccacatgatccataccgagcacaagggccagtatctgaccgaggag
gaactcgtctcgacgacgatcgtgctgctcaatgccgggcatgaggcgaccgtgcaccag
atcggcaactccgtgcgcaccattctcgacagcggctgcgatccggcggaactcttccgg
gacgaggcgacgacggagcgcaccgtcgaggaaaccctgcgcatctgcgcgccggtccat
atcttccagcgctgggccctggagcctgccgaaatcgacggcgtctccttcaagcgcggc
gacaaggtcagccttatcctcgccgccgccaatctcgatccggcgaaattcaccgacccc
ctcaccttcaagcccgaccgcaacgaggcggcgaacctctccttcggcgccggcatccat
ttctgcatcggcgcgccgttggcacggctcgagctcaacgtcgtgctgccgatcctgttc
gaacggctggccggcctcaagatggcaaagacacccgtggtcaaggacgtctaccatttc
cacgggctggaccggctggatctgcaatggtga

DBGET integrated database retrieval system