KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1698Help
Entry
RL1698            CDS       T00402                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RL1698
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RL1698
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RL1698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
1780253..1780801
Genome map
AA seq 182 aa AA seqDB search
MTGNVLDIPVKTVDGRETTLNEYKGRVLLVVNVASKCGLTVQYEGLEKLYGEKRERGFVI
AAFPANDFKGQEPGTDAEILDFCTSTYDVTFPIFSKISVRGEAQHPLYRQLTKAGVKTTG
DGPMRERLKSHGMTGGDEDDILWNFEKFLIGRDGKVAARFAPDVTADDSRLVSAVDKELS
KG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggcaatgtgctggatatcccggtcaaaacagtggatggtcgtgagaccacgctc
aacgaatacaagggcagggtgctcctggtcgtcaatgtcgcctcgaaatgtgggctgacc
gtccaatatgagggattggaaaagctctatggggaaaagcgcgagcgcggcttcgtcatc
gccgcctttcccgccaacgacttcaagggtcaggagcccggcaccgacgccgagatcctc
gatttctgcaccagcacctatgacgttaccttcccgatcttctcgaagatctcggtcagg
ggcgaggcccagcatccgctttaccggcagctgaccaaggcgggtgtgaagacgacgggt
gacggcccgatgcgcgaacgcctgaaatcccacgggatgactggcggcgatgaggacgac
atcctctggaacttcgaaaaattcctgatcggccgtgacggcaaagtcgccgcccgattc
gcgccggatgtgacggccgacgattcgcggctggtttcggcggtggataaagaactgtcg
aagggatga

DBGET integrated database retrieval system