KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1739Help
Entry
RL1739            CDS       T00402                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rle00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rle00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(1828951..1829907)
Genome map
AA seq 318 aa AA seqDB search
MVFFPHRHLIGIKGLTEQDITYLLDKADEAVKISRQREKKTSTLRGLTQINLFFEASTRT
QASFELAGKRLGADVMNMSVGNSSVKKGETLIDTAMTLNAMRPDVLVIRHSSAGAAALLA
QKVSCSVVNAGDGQHEHPTQALLDALTIRRAKGKLSRIIVAICGDVLHSRVARSNILLLN
AMGARVRVVAPATLLPAGIAEMGVEVFHSMREGLKDADVVMMLRLQRERMSGAFVPSVRE
YYHFYGLDAETLKAAKDDALVMHPGPMNRGVEIASEVADGPQSVIAEQVEMGVAVRMAVM
ETLLVSQNQGPRSDGMMA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggtctttttcccccaccgccacctcatcggcatcaagggcctcaccgagcaggatatc
acctatcttctcgacaaggcggacgaggccgtcaagatcagccgccagagagagaagaaa
acgtcgacgctgcgcgggctgacgcagatcaacctcttcttcgaggcatcgacccgcacg
caggcctccttcgagcttgccggcaagcggctcggcgccgacgtcatgaacatgtcggtc
ggcaattcctctgtgaagaaaggcgaaacgctgatcgacacggcgatgacgctgaatgcg
atgcgccctgatgtgctggtgatccgccattcgagcgcgggagcggccgcccttctcgcc
cagaaggtctcctgttcggtcgtcaatgccggcgacgggcagcatgaacatccgacccag
gcgctgctcgacgcgctgacgatccgccgcgccaaggggaagctgtcgcgcatcatcgtg
gcgatctgcggcgacgtgctgcattcgcgggtggcgcgctccaatattctgctgctcaat
gccatgggcgcccgcgtccgtgtcgttgcgcccgcgaccctcctgccggccggcatcgcc
gagatgggcgtcgaggtcttccattcgatgcgggaagggctgaaggacgccgacgtggtg
atgatgctgcggctgcagcgcgagcgcatgtccggcgccttcgtgccttcggtgcgcgaa
tactatcacttctacgggctcgacgccgaaacgctgaaagcggcgaaggacgacgcgctg
gtcatgcatcccggcccgatgaatcgcggcgtcgagatcgcttcggaagtggcggacgga
ccgcagagcgtcatcgccgaacaggtggaaatgggggtcgcggtgcgcatggccgtcatg
gagacgctgctcgtctcgcagaaccagggtccccgaagcgatggaatgatggcatga

DBGET integrated database retrieval system