KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1876Help
Entry
RL1876            CDS       T00402                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RL1876 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RL1876 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    RL1876 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RL1876 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RL1876 (adh)
   00626 Naphthalene degradation
    RL1876 (adh)
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RL1876 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
1970878..1971873
Genome map
AA seq 331 aa AA seqDB search
MEGNVRAMVLEQVRRPLRLVELPDPPAPPGQVVVKVEACGVCRTDLHVCDGDLSQPKLPL
VPGHEIVGTVIATGEGAPGRLVGRKIGVPWLGHTCGHCEYCREGRENLCDEPGFTGYTID
GGFATHAVVEAGYAFELPDDTDPVATAPLLCAGLIGWRSLKMAGEGRTIGIYGFGAAAHI
LVQVCKHRGQSVYAFVRAGDEAGRKFALDLGAVWAGFSGERPPVPLDAAIIFAPAGELVP
MALDIVRKGGTVVCGGIHMSDIPSMPYRLLWGERRVVSVANLTRNDGTEFFSIAKAAGVR
CVTSVYALEHANDALDDLRAGRLTGAAVIVP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagggaaacgtgagggcgatggtacttgaacaggtgcgacgtccgcttcgtctcgtg
gagctgcctgacccgccagcgccgcccggccaggtcgtcgtcaaggtggaggcctgcggc
gtctgccggacggaccttcacgtctgcgacggagacctctcccagccaaagcttcctctc
gttcctgggcatgagattgtgggaaccgtgatcgcaaccggcgagggcgctcccggtcgt
cttgtcggtcgaaaaatcggagtaccctggctgggccacacctgcgggcactgcgaatat
tgccgcgagggtcgcgagaacctgtgcgacgagcctggcttcactgggtacaccatcgac
ggcggcttcgcgacgcatgcggttgtcgaggcgggctacgcgttcgaactgcctgacgat
acggaccctgtggcgaccgctcctcttctgtgcgcgggcctcatcgggtggcgatccctg
aagatggcgggcgaggggaggacgatcggcatctacgggttcggcgcggccgcccacatc
ctcgtgcaggtatgcaagcatcgaggccagagcgtctatgcattcgtgcgtgccggagac
gaggccgggcggaagttcgcgcttgaccttggcgccgtctgggccgggttctccggtgaa
aggccgccggtgccgctcgacgccgccatcatcttcgcgccggccggcgaactcgtgccg
atggcgctcgacatagtgcggaagggcggaacggtggtctgcggcggcatccacatgtcg
gacatcccaagcatgccctaccgtctgctctggggtgagcggcgagtggtctcggtggcg
aatctgacccggaacgacggaaccgaattcttctcgatcgcgaaggcggccggcgtccga
tgcgtcaccagcgtctacgctctcgagcacgcgaacgatgccctcgacgacctgcgagca
ggccgcctcaccggcgcagccgtcatcgttccgtag

DBGET integrated database retrieval system