KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2033Help
Entry
RL2033            CDS       T00402                                 

Definition
(GenBank) putative protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
Enzymes [BR:rle01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RL2033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 Methyltransf_32 Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: CAK07525
GeneDB: RL2033
RhizoBase: RL2033
UniProt: Q1MHN8
Position
2140993..2141658
Genome map
AA seq 221 aa AA seqDB search
MMDFEAARVKMVDTQVRTTDVTSHSVLTAFLTVPREAFVPEKAKLLAYIDNDVEISAAAP
GKPARFLMEASPLAKLLQLAAITKDDFVLEVGCGTGYTSALLSIIAGSVIALECDETLAT
EAKAQLAGYAKVEVVTGPLEKGYAAGAPYDLIFINGAVEEVPAALLGQLRDGGRLITVEG
YGNAARAKVFVAERGAISENVFFNASVKPLPGFAKAREFVF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatggatttcgaagcagcgcgcgtaaagatggtcgatacccaggttcgcacgacggac
gttacctcgcattccgtgctgacggcgtttctcacggtgccgcgtgaggctttcgtgccg
gagaaggcgaagctgctggcttatatcgacaacgacgtcgagatctccgcagctgcaccg
ggaaagccggcccgcttcctgatggaagcatcgccgcttgccaagctgctgcagctggca
gcgatcaccaaagacgacttcgtgctcgaggttggttgcggtacgggttacacttcggcg
ctgctgtcgatcattgccggctccgtcatcgcgctcgaatgcgacgagacgctggccact
gaagcgaaggcgcagcttgccggctacgccaaggtcgaagtcgtgaccggcccgctcgaa
aagggctacgctgccggcgctccctatgatctgatcttcatcaacggcgcggtcgaagag
gttccggccgcccttctcggtcaattgcgcgatggtggccgtctgatcaccgtcgagggt
tacggcaatgccgcccgcgccaaggtcttcgtcgccgagcgcggcgccatttcggaaaac
gtcttcttcaacgcctcggtcaagccgctgccgggtttcgccaaggcgcgcgaattcgtt
ttctga

DBGET integrated database retrieval system