KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2243Help
Entry
RL2243            CDS       T00402                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RL2243 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RL2243 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RL2243 (pdhC)
   00620 Pyruvate metabolism
    RL2243 (pdhC)
Enzymes [BR:rle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RL2243 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
2365182..2366537
Genome map
AA seq 451 aa AA seqDB search
MPINITMPALSPTMEEGNLSKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKLV
VAAGTEGVKVNALIAVLAADGEDVAAAASAAGSAAPAPKADGAAAPKAEAAPAPAQSTPA
AAPAPAAAPASVSADGNRTFSSPLARRLAKEAGIDLSAVAGTGPHGRVVKSDIEAAVAGG
AAKAAAPAAAASAPQASAAPAAAPKGASEEAVLKLFEPGSYELVPHDGMRKTIARRLVES
KQTIPHFYVSVDCELDALLALRAQLNDAAPRKDNAPAYKLSVNDMVIKAMALSLRDVPDA
NVSWTDSNMVKHKHADVGVAVSIPGGLITPIIRKAEEKTLSTISNEMRDLGKRAKDRKLK
PEEYQGGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKKGEMAIATVMSVTL
STDHRCVDGALGAELLQAFKGYIENPMGMLV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcacgatgcccgccctctctccgaccatggaggaaggcaatctttcc
aaatggctggtcaaggaaggcgacaaggtcaaatctggcgacgtcatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgatgaaggcacggtcgccaagctcgtc
gttgcggccggcaccgaaggcgtcaaggtcaatgcgctgatcgcggttctcgccgccgat
ggcgaggacgtcgctgctgccgcaagcgctgcgggttccgccgccccagcgccgaaggca
gacggtgcggccgcgccgaaggccgaagctgcaccggctccggcgcagtccactccggct
gcagcgccagcacccgccgccgcacccgcatcggtttcggctgatggcaaccgcaccttc
tcttcgccgcttgcccgcagactggccaaggaagccggtatcgatctttcggcagtcgca
ggcaccggcccgcacggccgcgtcgtcaagagcgacattgaagccgccgttgccggtggc
gccgccaaggccgcagcacccgccgccgctgcctccgctccgcaagcctcggcggctccg
gccgccgcgccgaagggcgcatccgaagaagccgtgctcaagctcttcgagcctggttcc
tacgagctcgtgccgcatgacggcatgcgcaagacgatcgccaggcgcctggtcgaatcc
aagcagacgatcccgcatttctacgtcagcgtcgattgcgagctcgatgcgctgctggcg
ctgcgcgcccaactgaacgatgcggctccgcgcaaggacaacgctccggcctacaagctc
tcggtcaacgacatggtcatcaaggccatggcgctgtcgctgcgcgacgttccggatgcc
aacgtctcctggaccgacagcaacatggtcaagcacaagcacgccgatgtcggcgtcgcc
gtctcgatccccggcggcctgatcaccccgatcatccgcaaggccgaggaaaagacgctg
tcgacgatctccaacgagatgcgcgatctcggcaagcgggccaaggaccgcaagctgaag
cccgaggaatatcagggcggcaccagctcggtctcgaacatgggcatgatgggcgtgaag
aacttcgcagccgtcgtcaacccgccgcatgcgacgatcctcgcggtcggcgccggtgaa
cagcgggtcgtcgtcaagaagggcgaaatggcgattgccaccgtgatgtcagtcacgctc
tcgaccgaccatcgctgcgtcgacggcgcgctcggcgccgagctgctccaggccttcaag
ggctacatcgaaaacccgatgggcatgcttgtctga

DBGET integrated database retrieval system