KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2413Help
Entry
RL2413            CDS       T00402                                 

Definition
(GenBank) putative glycosidase
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00500  Starch and sucrose metabolism
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RL2413
Enzymes [BR:rle01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RL2413
Exosome [BR:rle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RL2413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C CBM_48 GHL6 DUF3459 Cellulase
Motif
Other DBs
NCBI-ProteinID: CAK07903
GeneDB: RL2413
RhizoBase: RL2413
UniProt: Q1MGL6
Position
2542554..2544926
Genome map
AA seq 790 aa AA seqDB search
MTVNVQFRFRSGLPLMAFDNVRLRGSWDEQGHPANGWTSHPMQRSRDEDGYDVFVARVPF
PDGEIGTHFRWGIELDRPGIPDLWAIAAELDDEASSRRECSFDLQQGIGPQTYYLTWIGR
LGANRVEKRNSADGIRFSVWAPNARAVSLVLADPAVGYIADDGTGTIATIGMRRTVDGFW
SVETGEDHDLADFDSMVGTPYMYRITRDDGSLAYRTDIWSLMQIGAGDFDPDGAAYHGPP
AALDGPQSCSVVCDPKRVVLPSGEEVAAETFWADEFVGGRTLPERLEDLVIYELHVGALG
FGKATPGTLDDAIAFVEHLSALGVNAVELLPIAEFETRANWGYGTSHFFAADQGAGGTDR
LKMFVKACHRRGIAVILDVCYNHFDPDGERAQWAYDSNDHTRNIYYWYEGRPGDYADPTG
GYIDNISTGWAPRFHEEAVRQLFISSAAFLVSVCHIDGFRLDQTSSIHQYPVVHADGRRA
DRAAASGAKFLKQWTRTMRLIKPQLFLTAEDYSDWSAMTEPSLTGDGLGFDATWYGDFHH
NLVEYHRGAQAQLLKNAGFGDKRALTMSSLAGALQTSARSKVVYNQSHDDCGNREGSART
TVIAVNFAPVVGETRAWAEARSRFAAAMTLLSPGTPMFFMGEEIGAQKPYRYNDFLDNRE
NILGEADGSGAAMISCYRDLIALSVQQDAIRSRNIAIPLVHDENRVIAFHRWNDGEDFLV
VGSLNDAPFEHGYRLYSERLGDDLWEEIFNTDAQIYGGWNVGNGGGRIRATAGVLNAVLP
ASGVLVFRKL
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaacgttcaatttcggtttcgcagcggtttgccattaatggccttcgacaat
gtccgtctccgcggcagttgggacgagcaaggccatcccgcgaacgggtggacgtctcat
ccgatgcagcgctctcgtgacgaggatggctatgatgtttttgtcgcccgcgtgcccttt
cccgatggcgagatcggtacgcattttcgctgggggatcgaactcgatcggccgggcatt
ccagacctatgggcgatcgccgctgaattggacgatgaggcctcctcgcgccgcgaatgc
tccttcgatctccagcaggggatcgggccgcagacctattatctaacatggatcggccgt
ctgggggcgaaccgggttgagaagcgcaacagtgccgacggcatccgcttttcggtctgg
gcgccaaacgccagggccgtttcactcgtgctcgccgatcccgccgtcggttacatcgcc
gatgacggcaccggaacgatcgcaaccatcgggatgcgaaggaccgttgatggattctgg
agcgttgaaaccggcgaggaccacgaccttgccgatttcgacagcatggtcggcacgccc
tatatgtaccgcatcaccagggacgatggatcgctcgcctaccgcacggatatctggtcc
ctcatgcagatcggcgcgggagacttcgatcccgacggagccgcctatcacggaccgccg
gcggcattggacggaccacaaagctgttcggtggtctgcgacccgaagcgggtggtgctg
ccgtccggggaggaggttgccgccgagacgttctgggctgacgaattcgttggcggccga
acacttccggagcggctcgaggatctggtgatctacgaattgcacgtcggcgcactcggt
ttcggcaaggccacgcccggcacgcttgatgatgccattgccttcgtcgagcatctgtcg
gcgctcggcgtcaacgccgtggaactgctgccgattgccgaattcgagacgcgggccaac
tggggttacggcacgtcgcatttctttgccgccgatcagggggctggcggcaccgaccgg
ctgaagatgttcgtcaaggcctgccaccggcgcggcatcgccgtcatcctcgatgtttgc
tacaaccacttcgatccggacggcgaacgggcgcaatgggcctatgattccaacgatcac
acccgcaatatctattattggtacgagggacgccccggcgattacgccgacccgacaggc
ggctatatcgacaacatctcgacgggatgggcgcctcgcttccatgaggaagccgtgcgc
cagcttttcatctcgagcgcggcatttcttgtctcggtctgccatatcgatggtttccgg
ctcgatcagacaagttcgatccatcaatatccggtcgtgcatgccgatggccggcgcgcc
gatcgggcggctgcatcaggcgccaaattcctaaagcagtggacccgcacgatgcggctg
atcaagccgcagcttttcctgacggccgaggactattcggactggtcggcgatgacggag
ccaagcctgaccggcgacgggctcggcttcgatgcgacctggtacggcgattttcatcac
aacctcgtcgaatatcaccgtggcgcgcaggcgcagctgttgaagaatgccggtttcggg
gacaagcgggcgctgaccatgtcgtctcttgccggcgcattgcagacaagcgcgcgatcc
aaggtggtttacaaccagtcgcatgacgattgcggcaatcgtgaaggatcggcacgaacc
actgttatcgcggtcaatttcgcgcctgttgtcggcgagaccagggcatgggcagaggcg
agatcccgattcgcggcggcgatgacgctgctatccccgggcacgccgatgtttttcatg
ggcgaggaaatcggcgcccagaaaccctatcgctacaatgatttcctcgacaaccgggag
aatattctcggcgaagctgatggcagcggggcagcgatgatcagctgttatcgcgatctg
atcgcgctgagcgtccaacaggatgccattcgctcccgcaacatcgccattcccctggtt
cacgatgaaaatcgggtgatcgcgtttcatcgatggaacgacggcgaggatttcctcgtt
gtggggtcgctgaacgacgctcccttcgaacacggctatcggctgtacagcgaacgtctg
ggcgatgacctctgggaggagatcttcaataccgatgctcagatatatggcggctggaac
gtcggtaatggcggcggaagaatcagagccacggcgggagtgctgaatgccgtgttgccg
gcatcaggcgttctggtctttcgtaagctgtga

DBGET integrated database retrieval system