KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2417Help
Entry
RL2417            CDS       T00402                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RL2417
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RL2417
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RL2417
Enzymes [BR:rle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     RL2417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
2546357..2547187
Genome map
AA seq 276 aa AA seqDB search
MKIIQITDTHFSPGKPHFNGNWAPLLSWIEATGADLIVHTGDLTVDGADKDVDITFSMDL
MRQVSIPMLIVPGNHDVGHLNGSDQPVNAERLSRWRSLAGDDRWLEDAAGWRFIGLNSLL
LGHEDDEEEAQFEWLHQALSDRAGRRVALFAHKPLFVDEPDEGDTGYWSVRPAQRRRLYD
LIAAHDVALFASGHLHWAWQGRFDNTQLTWGPSAAFIIDKMERAMPGERLIGAVVHEFDS
GVESRIVAVPGMTAYVLDDVVHEVYPQAVKPREPVE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcattcagatcaccgacacccatttcagccccggcaagccgcatttcaacggc
aactgggcgccgcttctgagctggatcgaagcgaccggcgccgacctgatcgtccatacc
ggcgatctcaccgtcgatggcgccgacaaggacgtggatatcaccttttccatggatctg
atgcgtcaggtgtcgatcccgatgctgatcgtccccggcaaccacgatgtcggccacctc
aatggatcggatcagcccgtcaatgccgagcggctgtcccgctggcgcagccttgccggc
gatgaccgctggctggaggatgcggccggctggcgcttcatcggattgaactcgctgctt
ctcggtcatgaggatgacgaggaagaggcgcagttcgaatggctccaccaggcgctgtcc
gacagggcagggcggcgggtggcgctgttcgcgcacaagccgcttttcgtcgatgaaccc
gacgaaggcgataccggatattggagcgttcgcccggctcagcgccggcggctctatgat
ctgatcgctgcccatgacgtggcgctgtttgcgagcggccatctccattgggcctggcag
gggcgcttcgacaatacccaactgacatggggtccgtcggccgccttcatcatcgacaag
atggagcgcgcgatgccgggcgagcgcctgatcggcgcggtcgtccacgagttcgatagt
ggtgtcgaaagcaggatcgtcgccgttcccggcatgaccgcgtatgtgctcgacgatgtc
gtgcacgaagtctacccccaggcggtcaagccgcgggaaccggtcgaatga

DBGET integrated database retrieval system