KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2427Help
Entry
RL2427            CDS       T00402                                 

Definition
arginase (EC:3.5.3.22)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RL2427
Enzymes [BR:rle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RL2427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
2558360..2559271
Genome map
AA seq 303 aa AA seqDB search
MTASPSFLGLPDRLADGRLPRAVIFAAAHGSTYPGKDGSGYVLAAGAIRAASQDDAALVE
HWDFDLGGPLFDHNPVCCIDAGDVPTILHDNAGNRARIEARTREVLSMPAVPILLGGDCS
VTIPFLAGFADHEPVWILQIDAHIDWRDEVHGERHGYSSPMRRASEMPHVAGMVQVGLRS
VGSARLADIESARAYGSRFVTAREIHAEGVEAALRHIPEGAWVVVTLDCDSVDPGIMPGV
AARTPGGLTYTEVIDLIAGLGRRARIAGFDLVELYPPADIDGLSALTAARLLVNAVGAIV
RQD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctcaccttcctttcttggccttcccgatcgcctcgccgatggtcgcttgccc
cgagcggtgatcttcgcagccgctcacggcagcacctatcccggcaaggacggcagcggc
tatgtcttggccgccggtgccatccgcgctgcgagccaggatgatgccgcgctcgtcgag
cactgggatttcgatctcggcggtccgctgtttgaccacaacccagtctgctgcattgac
gctggcgacgttccaaccatccttcatgacaatgccggcaatcgagcccggatcgaggcg
aggacgcgcgaggtcctgtcaatgcccgcagtgccgatcctgctcggcggcgattgttcc
gtgactattcccttcctcgctggctttgcggaccacgagccggtctggatcctgcagatc
gacgcccatatcgattggcgcgacgaggtacatggcgagcgccacggctattcgagcccg
atgcgtcgggcgagcgagatgccgcatgtcgccggcatggtccaggtcggcctccgcagc
gtcggcagcgcacgcctcgccgatatcgaatcggcgcgggcctacggcagccgtttcgtg
accgcccgcgagattcacgccgagggggtcgaagccgctctccggcatattccggaagga
gcgtgggtcgtcgtcaccctcgactgcgacagcgtggatcccggcatcatgccgggtgtg
gcggcgcgcacgcccggcggcctcacctatactgaggtgattgacctgatcgcgggcctc
ggcaggcgggccaggattgcaggattcgaccttgtcgagctctatcctcccgctgatatt
gacggcctgtcggccctgaccgccgcgcgccttctcgtcaatgcagtcggcgccatcgtc
cggcaagactga

DBGET integrated database retrieval system