KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2498Help
Entry
RL2498            CDS       T00402                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RL2498
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RL2498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
2633259..2633633
Genome map
AA seq 124 aa AA seqDB search
MTKILASVVISTLILVSATAPAAAEGDVALGQKAFQRCSACHSTTDQKKAGPGLGGVVGR
AAGSVEGVRYSAAMKASGLVWDEATLDRFLAAPREVVPTTTMTVGVPKPEDRLNIIAYLK
SLSE
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattttggcctccgttgtgatctccaccttgatccttgtgtcggcgacggct
cctgcggcagcggagggagatgtcgccttgggacaaaaagcgtttcagcgctgttccgcc
tgtcattcgaccacggatcagaaaaaggctgggccggggctcggtggcgttgtcgggcgc
gcggccggctctgtagaaggcgtccgctattcggcggccatgaaggcgtcgggattagta
tgggacgaggcgacgttggaccgatttctagcagcgcctcgcgaggttgtaccgaccacc
acaatgaccgtgggcgtacccaagcctgaggatcggctaaacatcatcgcttacctgaag
tccctgtcggagtag

DBGET integrated database retrieval system