KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2513Help
Entry
RL2513            CDS       T00402                                 

Gene name
tpiA
Definition
(GenBank) putative triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00010  Glycolysis / Gluconeogenesis
rle00051  Fructose and mannose metabolism
rle00562  Inositol phosphate metabolism
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01130  Biosynthesis of antibiotics
rle01200  Carbon metabolism
rle01230  Biosynthesis of amino acids
Module
rle_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RL2513 (tpiA)
   00051 Fructose and mannose metabolism
    RL2513 (tpiA)
   00562 Inositol phosphate metabolism
    RL2513 (tpiA)
Enzymes [BR:rle01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RL2513 (tpiA)
Exosome [BR:rle04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RL2513 (tpiA)
  Exosomal proteins of bladder cancer cells
   RL2513 (tpiA)
  Exosomal proteins of melanoma cells
   RL2513 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAK08001
GeneDB: RL2513
RhizoBase: RL2513
UniProt: Q1MGC2
Position
complement(2650444..2651214)
Genome map
AA seq 256 aa AA seqDB search
MTPDVRPLVAGNWKMNGMRASLDQIKTIAEGVRPPLADKVEALICPPATLLYVATALCTD
SPLAIGAQDCHQNPSGAHTGDISAEMIADCFGTYVIVGHSERRTDHAETDHLVRAKAEAA
FAAGLTAIICIGETADERRTGQALDVIKRQLSASVPDCATAESTVIAYEPIWAIGTGVTP
TSGDVEKAHAFMRAELAVRFGDEGRKMRLLYGGSVKPANAHELMGIANVDGALIGGASLK
AADFLAIYRAYEALLA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacacctgatgtacgcccgcttgtggcgggaaactggaaaatgaatggcatgcgtgcc
tcgctggatcagatcaagacgatcgccgagggtgttcgcccgccgctggccgacaaggtc
gaagcgctgatctgcccgccggcgacgctgctctatgtggcgacggcgctgtgcaccgat
agcccgctggcgatcggcgctcaggactgccatcagaacccatcaggtgcgcataccggc
gacatctcggccgagatgattgccgattgtttcggcacctatgtcatcgtcggccattcc
gagcggcgcaccgaccatgccgaaacggatcatctggtacgcgccaaggcggaggccgcc
tttgctgccgggctgacggcgatcatctgcatcggcgagaccgcggatgaacgccggaca
ggccaggcgctcgacgtcatcaagcgccagctttccgcctcggttccggactgcgccacc
gctgagagcacagtcatcgcctacgagccgatctgggcgatcggcaccggcgtgacgccg
acatcaggtgatgtcgaaaaggcgcatgccttcatgcgggcagagcttgcggtccgcttc
ggcgacgaaggccgcaagatgcgtcttctctatggcggctcggtcaagccggccaatgcc
catgagttgatgggcattgccaatgtcgacggcgcgctgatcggcggagcgagcttgaaa
gcggccgacttcctcgccatctaccgggcctatgaggcgctgctcgcctga

DBGET integrated database retrieval system