KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2531Help
Entry
RL2531            CDS       T00402                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rle00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
2669920..2670534
Genome map
AA seq 204 aa AA seqDB search
MDAIVKNFPQTTRDSDRPSQQEAEEAVRVLLRWAGDDPTREGLLETPARVVKSYRELFSG
YDMAAEDVLGRTFEEVAGYDDMVLVKDIPFYSHCEHHMVPIIGKAHVAYMPDGRVLGLSK
IARVVEIYGRRLQTQETMTAQIARAIDDTLNPRGVAVLIEAEHMCMAMRGVQKQGSTTLT
TTFTGTFKTEPADQARFMTMVRSR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcgtaaagaattttccgcagacgacccgcgactcggatcgcccctcccag
caggaggcggaggaagccgttcgcgtcctgctgcgctgggccggtgacgacccgacacgc
gaaggcttgctcgaaacgccggcccgcgtcgtcaaatcgtaccgcgagcttttttccggt
tacgacatggcggcggaagacgtgctcggtcgcaccttcgaggaggtcgccggttatgac
gacatggtcctcgtcaaggacattccattttactcgcattgcgaacaccacatggtgccg
atcatcggcaaggcccacgttgcctacatgcctgatggccgtgtgctcggcctgtcgaag
attgcccgtgtcgtcgagatctatggccgccgcctgcagacgcaggaaacgatgaccgcg
cagatcgcccgggccatcgacgatacgcttaatccgcgcggtgtcgccgtgctgatcgag
gccgaacatatgtgcatggcgatgcgcggcgttcagaagcagggctcgaccacgttgacg
acgacatttacgggaacgttcaagactgagccggccgatcaggcccgcttcatgaccatg
gtgcggagccgctga

DBGET integrated database retrieval system