KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2665Help
Entry
RL2665            CDS       T00402                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RL2665
   01230 Biosynthesis of amino acids
    RL2665
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RL2665
  Energy metabolism
   00680 Methane metabolism
    RL2665
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RL2665
Enzymes [BR:rle01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RL2665
Exosome [BR:rle04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RL2665
  Exosomal proteins of melanoma cells
   RL2665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
2813734..2814483
Genome map
AA seq 249 aa AA seqDB search
MRLFLVRHGESLGNINEQAYRQFGDHNVPLTRWGHRQALEAGGVIASYLKALPSAGFGKL
HVWYSPFLRTRQSKDALLEALPESFVGDIREDYLLREQDFGLFTEIYDHAEQKQKFPEEF
EKWARLRSNSGKFYARPPDGESRADVAQRVRLFLQTVMHDAENSDHNLVIVGHGVTNRAI
EMNFLHRPVEWFERSDNPGNADITLIEGTRSQGYESILLHQAADRQPGQEGELRDAYGAD
VTITPKPTA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctttctcgttcgccacggcgaatccctcggcaacatcaatgaacaggcctac
cgccaattcggcgatcacaacgtgccgctgacgcgatggggccatcggcaggctctcgag
gcaggcggcgtgatcgcgtcctatctcaaggcattgccgagcgcgggtttcggcaagctg
catgtttggtattcgccctttctcaggacccggcagagcaaggatgcgctgctcgaagcc
ctgccggaaagcttcgtcggcgatatcagggaggattatctgctgcgcgagcaggatttc
ggtctcttcaccgaaatctacgatcacgccgaacagaagcagaagtttcccgaggagttc
gaaaaatgggctaggctgcgcagtaacagcggcaagttctacgcccggccgccggatggc
gaaagcagggcggatgtggcccagcgggtgcgcctgttcctccagaccgtcatgcacgat
gccgaaaatagcgaccacaacctcgtgatcgtcggtcatggcgtcaccaaccgcgcgatc
gaaatgaacttcctgcaccgccctgtcgagtggttcgagcgctccgacaatcccggaaac
gccgatatcaccctgatcgaggggacgcgctcgcaaggatacgagtcgatcctgctgcat
caggccgccgaccggcagccaggacaggaaggcgaactgcgcgatgcctatggcgccgac
gtgacgatcacgccgaagccgaccgcataa

DBGET integrated database retrieval system