KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2705Help
Entry
RL2705            CDS       T00402                                 

Definition
(GenBank) putative GGDEF sensory box protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
Enzymes [BR:rle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     RL2705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
2863710..2864777
Genome map
AA seq 355 aa AA seqDB search
MNTAVAPKVQIPDVAGQITYAMRSMGVAPIPRNYQLFYEAYIGSNPALTRELAALGGQVT
QAELDALGAQHFTHSPARVFDDAHTRISGELDGLLRILRQEQNSLESYTRLLGETHKRIT
SKSNASVELIENAIELLSQATGDTMAHGERTVENVVQRSQEMDQVRKELDEYKRIANTDS
LTRLSNRRAFDDRLAAIFDNSSMRPVTALLLCDIDNFKKINDTYGHPVGDKVLATVASVI
RSNVRRDIFVARTGGEEFALIIDGNTPEEVTGIAERIRRTLETTPFKNSRTRVNYGPVTV
SIGICMASNAEDAGELYSKTDIALYGAKNAGRNCTILYQDGMQKDFTKSWLIYKT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggctgtcgcgcccaaggtgcagatccccgacgttgcgggtcagatcacctat
gccatgcgctccatgggcgtcgcgccgataccgcgcaattaccaactcttctacgaggcc
tatatcggctccaatccggccctgacccgcgaactcgcggccctcggcggccaggtgacc
caggccgagcttgatgcgctcggcgcgcagcacttcacccacagccctgcccgtgtcttc
gacgacgcccatacgcgtatatcaggcgaacttgatggcctgttgcgcattctcaggcag
gagcaaaactcgctcgaaagttataccaggcttcttggcgagacccataagcgcatcacc
tccaagagcaatgccagcgtcgaactgatcgaaaacgccatcgagctgctgagccaagcg
accggagacaccatggcgcatggtgaacgcaccgtcgagaacgtcgtccagcgctcgcag
gaaatggatcaggtccgcaaggaactcgacgaatacaagcggatcgccaacaccgactcg
ctgacgcgcctttccaaccgccgcgccttcgatgaccgcctcgccgccatcttcgacaat
tcgagcatgcggccagtgacggcgctgctgctctgcgacatcgacaatttcaagaagata
aacgacacctacggccatccggtcggtgacaaagtgctggccaccgtcgcctccgttatc
cgcagcaatgtccgtcgcgacatcttcgtcgcccgcaccggcggcgaggagttcgccctc
atcatcgacggcaacacgcccgaggaagtcaccggcatcgccgagcgcatccgccgcacc
ctggagacgacgcccttcaagaactcccgcacccgggtgaattacggtccggttaccgtc
tcgatcggcatctgcatggcctccaatgccgaggatgccggcgaactctacagcaagacc
gacatcgcactttacggcgccaagaatgccggccgcaactgcaccatcctctatcaggac
ggcatgcagaaggatttcaccaagagctggctgatttataagacgtga

DBGET integrated database retrieval system