KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2705Help
Entry
RL2705            CDS       T00402                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
2863710..2864777
Genome map
AA seq 355 aa AA seqDB search
MNTAVAPKVQIPDVAGQITYAMRSMGVAPIPRNYQLFYEAYIGSNPALTRELAALGGQVT
QAELDALGAQHFTHSPARVFDDAHTRISGELDGLLRILRQEQNSLESYTRLLGETHKRIT
SKSNASVELIENAIELLSQATGDTMAHGERTVENVVQRSQEMDQVRKELDEYKRIANTDS
LTRLSNRRAFDDRLAAIFDNSSMRPVTALLLCDIDNFKKINDTYGHPVGDKVLATVASVI
RSNVRRDIFVARTGGEEFALIIDGNTPEEVTGIAERIRRTLETTPFKNSRTRVNYGPVTV
SIGICMASNAEDAGELYSKTDIALYGAKNAGRNCTILYQDGMQKDFTKSWLIYKT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggctgtcgcgcccaaggtgcagatccccgacgttgcgggtcagatcacctat
gccatgcgctccatgggcgtcgcgccgataccgcgcaattaccaactcttctacgaggcc
tatatcggctccaatccggccctgacccgcgaactcgcggccctcggcggccaggtgacc
caggccgagcttgatgcgctcggcgcgcagcacttcacccacagccctgcccgtgtcttc
gacgacgcccatacgcgtatatcaggcgaacttgatggcctgttgcgcattctcaggcag
gagcaaaactcgctcgaaagttataccaggcttcttggcgagacccataagcgcatcacc
tccaagagcaatgccagcgtcgaactgatcgaaaacgccatcgagctgctgagccaagcg
accggagacaccatggcgcatggtgaacgcaccgtcgagaacgtcgtccagcgctcgcag
gaaatggatcaggtccgcaaggaactcgacgaatacaagcggatcgccaacaccgactcg
ctgacgcgcctttccaaccgccgcgccttcgatgaccgcctcgccgccatcttcgacaat
tcgagcatgcggccagtgacggcgctgctgctctgcgacatcgacaatttcaagaagata
aacgacacctacggccatccggtcggtgacaaagtgctggccaccgtcgcctccgttatc
cgcagcaatgtccgtcgcgacatcttcgtcgcccgcaccggcggcgaggagttcgccctc
atcatcgacggcaacacgcccgaggaagtcaccggcatcgccgagcgcatccgccgcacc
ctggagacgacgcccttcaagaactcccgcacccgggtgaattacggtccggttaccgtc
tcgatcggcatctgcatggcctccaatgccgaggatgccggcgaactctacagcaagacc
gacatcgcactttacggcgccaagaatgccggccgcaactgcaccatcctctatcaggac
ggcatgcagaaggatttcaccaagagctggctgatttataagacgtga

DBGET integrated database retrieval system