KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3046Help
Entry
RL3046            CDS       T00402                                 

Definition
(GenBank) putative exported cytochrome c
  KO
K08738  cytochrome c
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RL3046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Flg_bbr_C
Motif
Other DBs
NCBI-ProteinID: CAK08534
GeneDB: RL3046
RhizoBase: RL3046
UniProt: Q1MEU1
Position
complement(3210232..3210621)
Genome map
AA seq 129 aa AA seqDB search
MDYRVVLLIATSVIALSPADAGAQEGDATAGAAVFKKCVTCHVADSDTNKVGPSLNGLFG
RKAGTHPNYAYSAGMKAAGEGGLVWDETVLRDYLHNPKGKVKGTKMAFVGVKDDQEITNL
IAYLKQYSK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
gtggattaccgtgttgttctgctgatcgccacatccgtcattgctctttcccctgctgac
gccggggcgcaggagggcgatgcgacggcgggtgctgccgtttttaagaaatgcgtgacc
tgtcatgtcgccgattccgatacgaacaaggttggcccgtcgttgaacgggttgttcggc
cggaaggccggaacgcatcccaattacgcctattcggccgggatgaaggcggccggcgag
ggcggtctcgtctgggacgagacggtgctgcgtgactatctgcacaatccgaaggggaag
gtgaagggtacgaagatggccttcgtcggggtgaaggacgaccaggaaatcaccaatctc
atcgcctatctcaaacaatattccaagtga

DBGET integrated database retrieval system