KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3107Help
Entry
RL3107            CDS       T00402                                 

Gene name
bgaB
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rle00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(3263220..3265352)
Genome map
AA seq 710 aa AA seqDB search
MSDKTLSVWNPVKTDRFLVGAPHYPEHVDESYWERDAERMAKAGFNVVRMAEFAWHILEP
KLGTFDFDLFDRAIAMLGRYGIDTIMCTPTATPPRWLTVAHPEILRVDGKGRPMSHGSRQ
HCDTASPVFREHSRRITKAMAEHYRDNPFVVGWQTDNELNTSMPESFSKATLSEFQAFLA
GRYGEIGKLNTAWGGDFWATAYDGFDQVVLPIEFGPTFPSPGHLQDYHRFLAFSTARFQH
DQVEILRAVKPSWFVFHNLGGLRDIDFRGQFTTDLDFVGYDIYPMLYDEFQRLGNHAKVQ
ALHLDICRGFSGNYIVPEQQSGFGSQPGFCTLTPEPGELRRMALSSVAHGADGLMFFRWR
PAHFGAEIYWMGIIDHDDIGRHRYEEAKRFATEMTALKDKILGTYVRMDVGIAGSDFDNQ
EAHKTYPIGLPSPQDDAVLLHQYCYDRGIACGFIHPEDDLSKLKLLYVPHWVMWKDEWTE
RLKSFAEHGGTVVIGARTGTRNEDNHVIRETAPGTSLSQLTGVRVEDFGRLAAPGANGLF
DVMERSGGLVIPPNKPAESHRRERRFKIGNRELVGGYFYENLAIASDVEVVAAWSNRYAE
GQPMATSRKIGKGQVVYVGTYLTPDLTAALAERLFAPVGIEPLLGDLPEGVEVTMRMNDD
RRLLFIQNYTDQPAAIGGVPAGRDLLDDEKPVAGRLDLEGYGCAIIELAG
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacaagaccctctccgtatggaaccccgtcaagaccgaccgcttcctcgtcggc
gccccgcattatcccgagcacgtcgatgaaagctactgggagcgcgatgccgagcgcatg
gcgaaggccggcttcaacgtggtcagaatggccgaattcgcctggcatattctcgagccg
aagctcggcaccttcgatttcgacctgttcgatcgtgccatcgccatgctcgggcgctac
ggcatcgacacgatcatgtgcacgccgacggcaacgccgccgcgctggctgaccgtggcg
catccggagatcttaagggtcgacggcaaggggcggccgatgagccatggctcgcgccag
cactgcgacacggcaagtccggtctttcgcgaacacagccggcggattaccaaagcgatg
gccgagcattatcgcgacaatccttttgtcgtcggctggcagaccgacaacgagctgaac
accagcatgccggagagcttttcgaaggcgacgctttccgaattccaggcctttcttgcc
ggcagatatggcgagatcggcaagctcaatacggcgtggggcggcgatttctgggcgacg
gcctatgacggcttcgaccaggtggtgctgccgatcgagttcggcccgacctttccgagc
cccggccatctgcaggattatcatcgctttctggccttctcgacggcgcgcttccagcac
gatcaggtcgagatcctgcgggccgtgaagccttcctggttcgtctttcacaatctcggc
ggtcttcgggatatcgatttccgcggccagttcaccaccgatctcgatttcgtcggctac
gacatctatccaatgctctatgacgagttccagcggctcggaaaccacgccaaggtccag
gcgctgcacctcgatatctgccgcggcttctccggcaactacatcgtgcccgagcagcaa
tcgggcttcggcagccagccgggcttctgcacgctgacgccggagccgggggagctgcgc
cgcatggcgctttcctcggttgcccatggcgccgatggactgatgttcttccgctggcgg
cccgctcatttcggcgccgagatctactggatgggcatcatcgatcatgacgatatcggc
cgccaccgctatgaggaggccaagcgcttcgcgaccgaaatgacggcgctgaaggacaag
atcctcggcacctatgtgcgcatggatgtcggcatcgccggctccgatttcgacaatcag
gaagcgcacaagacctatccgatcggcctgccgagcccgcaggacgatgcggtcctgctg
caccaatattgctacgaccgcggcatcgcctgcggcttcattcatcccgaggacgatctt
tccaagctgaagctgctctatgtgccccattgggtgatgtggaaggacgaatggactgaa
aggctgaaatccttcgccgagcacggcggcaccgttgtcatcggcgcgcgcaccggcacg
cgcaacgaagacaatcacgtcatccgcgagaccgcgcccggcacgtcgctatcccagctc
acgggcgtgcgtgtcgaggatttcggccgtctcgccgcccccggcgccaatgggcttttc
gatgtgatggaacgttcgggcgggcttgtgattccgccgaacaagccggcggaatcgcac
cgccgcgaacgccgcttcaagatcggcaaccgcgaactggtcggcggctatttctatgaa
aacctggcgatcgcaagcgatgtcgaggtagttgcggcctggtccaaccgctatgccgag
ggccagccgatggcgacgtcgcgtaaaatcggcaaggggcaggtggtctatgtcggcacc
tatctcaccccggatctgacggcagcgcttgccgagcggctgtttgcacccgtcggcatc
gagccgttactcggcgaccttcccgagggcgtcgaggtgaccatgcggatgaatgacgac
cggcggctgctgttcatccagaactacaccgaccagccggccgccatcggcggcgttccc
gctggccgtgatctcctcgatgacgaaaaaccggttgccggtaggctcgatctcgaaggc
tacggctgcgcgatcatcgagctcgcggggtga

DBGET integrated database retrieval system