KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3279Help
Entry
RL3279            CDS       T00402                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    RL3279 (pncA)
Enzymes [BR:rle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     RL3279 (pncA)
    3.5.1.-  
     RL3279 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
3437331..3437960
Genome map
AA seq 209 aa AA seqDB search
MMKALLLVDIQNGFCPGGNLPVPDGDKVVPVANRLIDSGRYDLIVASQDWHPPGHGSFAS
AHPGAAPFEMGELSGKPQMMWPDHCIQGTLDAELHPELKSEEIDLIQQKGEDPDIDSYSA
FRDNDRDASTGLSDFLEDQGVTDLDVCGLATDYCVKFSALDALEMMPDVRVRFIEDASRG
ITPEGVAAAIEEMRTHGIAIIDSAKVLAG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaagcgctgctgctcgtcgatattcagaacggcttctgtccaggcggcaatctg
ccggtgcctgacggcgacaaggtggtccccgtcgcaaacagactgatcgacagcggcaga
tacgatctgatcgtcgcctcgcaggactggcatccgccgggccacggcagcttcgcctcc
gcccatccgggcgccgcccccttcgagatgggcgaactgtcgggcaagccgcagatgatg
tggccggaccactgcattcagggtacgctcgatgccgaactgcatccagaactcaaatcc
gaagagatcgacctgatccagcagaagggcgaggatcctgatatcgacagctattcggcc
ttccgcgacaatgaccgcgatgcctcgaccggcctttccgatttcctcgaggatcagggc
gtcaccgacctcgacgtctgcgggctggcgaccgactattgcgtcaagttctccgcgctc
gacgcgctggagatgatgcctgacgttcgcgtgcgcttcatcgaggatgcaagccgcggc
atcacgcccgagggcgtcgccgccgccatcgaggaaatgcggacgcatggcatcgcaatc
atcgacagcgccaaggtcctggccggctga

DBGET integrated database retrieval system