KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3344Help
Entry
RL3344            CDS       T00402                                 

Definition
dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RL3344
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RL3344
  Lipid metabolism
   00071 Fatty acid degradation
    RL3344
  Amino acid metabolism
   00350 Tyrosine metabolism
    RL3344
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RL3344
   00626 Naphthalene degradation
    RL3344
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RL3344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(3509650..3510801)
Genome map
AA seq 383 aa AA seqDB search
MSSNITANWSYPTSVKLGRGRIAELADACKSLGIKKPLLVTDRGLASMAITKTALDILED
AGLGRAIFADVDPNPNEKNLEAGVRAFKDGGHDGVVAFGGGSGLDLGKCVAFMAGQTRPV
WDFEDIGDWWTRASLEGIAPIVAVPTTAGTGSEVGRASVITNSETHVKKIIFHPKFLPGV
VISDPELTVGMPKIITAGTGMDAFAHCLEAYSSPFYHPMSAGIALEGMRLVKEFLPRAYR
EGTDLEARANMMAAAAMGAVAFQKGLGAIHALSHPIGAVYNTHHGMTNAVVMPAVLRFNR
KAIEEKIGRAAAYLGISGGFDGFYDYVLKLRSELGVPETLSAMGIAADRIDELSAMAIED
PSAGGNPIAMTLENTKALFRDCF
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaacatcaccgcaaactggagctatccgacatcggtcaagctcggccggggc
cgcatcgcggaactggccgacgcctgtaaaagcctcggcatcaagaagccgctgctcgtc
accgaccgtggccttgcctcgatggcaatcaccaagactgcgctcgatatcctcgaagat
gccggtctcggccgggcgatctttgccgatgtcgatccaaacccgaacgagaagaacctc
gaagccggcgtcagggccttcaaggacggcggccatgacggcgtcgttgctttcggtggc
ggctccggcctcgatctcggcaagtgcgtcgctttcatggccggccagacgcggccggtt
tgggacttcgaagatatcggcgactggtggacgcgtgcgagcctcgagggcatcgccccg
atcgtcgcggtgccgacaacggcaggcaccggttcggaagtcgggcgcgccagcgtcatc
accaattccgaaactcatgtgaagaagatcatcttccatccgaagttcctgcctggcgtc
gtcatttccgatccggaactgacggttggcatgccgaagatcatcacggccggcaccggc
atggatgctttcgcccattgcctggaggcctattcctcgccgttctatcacccgatgtca
gccggcatcgcgctcgaaggcatgcggctcgtcaaggaattcctgccgcgcgcctatcgg
gaaggcacggatctggaggctcgcgccaacatgatggccgccgccgccatgggcgcggtc
gccttccagaaggggctcggcgccattcacgcgctgtcgcacccgatcggcgccgtctac
aacacccatcacggcatgaccaacgcggtggtgatgccggcggtgctgcgctttaaccgc
aaggcgatcgaggagaagatcggccgtgcggcggcctatctcggcatttcgggcggtttc
gacgggttctacgattatgtgctgaagctccgctccgaactcggcgtgccggagacgctg
tcggcaatgggaatcgctgccgaccgcatcgacgaattgtcggccatggcgatcgaagat
ccgagtgctggcggcaacccgattgcaatgacgctcgaaaataccaaggcccttttcagg
gattgcttctga

DBGET integrated database retrieval system