KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3569Help
Entry
RL3569            CDS       T00402                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rle00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rle00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
3750074..3750850
Genome map
AA seq 258 aa AA seqDB search
MSRTVVVTGSTSGIGLAIATAFAETGDNIVINGFGKADEIKAIVERLESLSKGRALYHPA
DMTKPAEIADLIETAAKTFGTVDVLVNNAGIQHVEKIEDFPIEKWDQIIAINLSSSFHTM
RAAIPLMKAKKYGRIINIASAHGLVASPFKSAYVAAKHGILGLTKTAALELAEFGVTVNA
ICPGYVLTPLVEKQIPDTAKARGMTEEQVKSEVILKAQPTHEFVKAEEIGALSLYLASDA
ARQVTGTHISIDGGWTAA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaacagtcgtcgtcaccggttccaccagcggcatcggccttgcgatcgccact
gccttcgccgaaacgggcgacaacatcgtcatcaacggtttcggaaaggccgatgaaatc
aaggcgatcgtcgaacggcttgaatcattgtccaaaggccgggcgctctatcatccggcc
gacatgacgaagcccgccgagatcgccgacctgatcgaaacggcggcgaagaccttcggc
accgtcgatgtcctggtcaacaatgccggcatccagcatgtcgagaagatcgaggatttc
ccgatcgagaaatgggaccagatcatcgcgatcaatctgtcgagctccttccataccatg
cgcgccgcgatcccgctgatgaaggcgaaaaagtacggccgcatcatcaacatcgcctcc
gcccacgggctcgttgcctcccccttcaaatccgcctatgtcgcggcaaaacatggtata
ttgggcctgaccaagacggcggcgctggaacttgccgaattcggcgtaaccgtgaacgcc
atctgccccggctacgtgctgacgccgctcgtcgagaagcagataccggatacagccaag
gcgcgcggcatgaccgaggaacaggtaaagagcgaggtcatcctcaaggcgcagccgacg
catgaattcgtcaaggccgaggaaatcggcgcgctatcgctctaccttgccagcgacgcg
gcccggcaagtgaccggaacgcatatctcgattgacggtggctggacggcggcttaa

DBGET integrated database retrieval system